KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2165Help
Entry
Bmul_2165         CDS       T00624                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bmul_2165
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bmul_2165
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bmul_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2382263..2383291)
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFQNRAQLTALTDAIRAVRDDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGQSQVIGDRAFHRDPRVVTLLAKSLNHGLALAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLETILAQDVAPYDWLGLSLSAVIPAHVIYTQVDARPAGFSRVWLQDIL
RGRLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPEAAEVVLNELKAE
RNADSARRIKRMRARGKALKWDKLIEQPEYRRAQALLADALR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacggccctgtcacgcgac
gatgcgcggcgtctcgcgcatccgaacaccggcggcgtgatcctgttcgcgcggcacttt
cagaaccgcgcgcaactgaccgcgctgaccgatgcgatccgcgcagtgcgcgacgatatc
ctgatcgcggtcgatcacgaaggcgggcgcgtgcagcgcttccgcaccgacggcttcacg
gtgctgccggcgatgcgccgcctcggcgagctatgggatcgcgacgtgctgctcgcgacg
aaagtggcgaccgcggtcggctacatccttgccgccgagctgcgcgcgtgcgggatcgac
atgagctttacgccggtgctcgacctcgactacggtcagtcgcaggtgatcggcgatcgg
gcgttccatcgcgatccgcgcgtcgtcacgctgctcgcgaagagcctcaatcacgggctt
gcgctcgccggcatggcgaactgcggcaagcatttccccggccacggcttcgcggaagcg
gactcgcacgtcgcgctgccgaccgacgaccgtccgctcgagacgatcctcgcacaggac
gtcgcgccgtacgactggctcggcctgtcgttgtcggccgtgattcccgcgcacgtgatc
tatacgcaggtcgacgcgcgcccggccggcttctcgcgcgtctggctgcaggacatcctg
cgcggccggctcggctttaccggcgcgatcttcagcgacgatctgtcgatggaagccgcg
cgcgagggcggcacgctgacgcaggccgccgacgcggcgctcgccgccggctgcgacatg
gtgctcgtgtgcaatcagccggaagcggccgaagtggtcctgaacgagctgaaggccgag
cgcaatgccgattccgcacggcgcatcaagcggatgcgcgcacgcggcaaggcgctcaag
tgggacaagctgatcgagcagcccgagtatcggcgcgcgcaggcgctgctggccgacgcg
ctccgataa

DBGET integrated database retrieval system