KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2165Help
Entry
Bmul_2165         CDS       T00624                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bmu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2382263..2383291)
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFQNRAQLTALTDAIRAVRDDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGQSQVIGDRAFHRDPRVVTLLAKSLNHGLALAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLETILAQDVAPYDWLGLSLSAVIPAHVIYTQVDARPAGFSRVWLQDIL
RGRLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPEAAEVVLNELKAE
RNADSARRIKRMRARGKALKWDKLIEQPEYRRAQALLADALR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacggccctgtcacgcgac
gatgcgcggcgtctcgcgcatccgaacaccggcggcgtgatcctgttcgcgcggcacttt
cagaaccgcgcgcaactgaccgcgctgaccgatgcgatccgcgcagtgcgcgacgatatc
ctgatcgcggtcgatcacgaaggcgggcgcgtgcagcgcttccgcaccgacggcttcacg
gtgctgccggcgatgcgccgcctcggcgagctatgggatcgcgacgtgctgctcgcgacg
aaagtggcgaccgcggtcggctacatccttgccgccgagctgcgcgcgtgcgggatcgac
atgagctttacgccggtgctcgacctcgactacggtcagtcgcaggtgatcggcgatcgg
gcgttccatcgcgatccgcgcgtcgtcacgctgctcgcgaagagcctcaatcacgggctt
gcgctcgccggcatggcgaactgcggcaagcatttccccggccacggcttcgcggaagcg
gactcgcacgtcgcgctgccgaccgacgaccgtccgctcgagacgatcctcgcacaggac
gtcgcgccgtacgactggctcggcctgtcgttgtcggccgtgattcccgcgcacgtgatc
tatacgcaggtcgacgcgcgcccggccggcttctcgcgcgtctggctgcaggacatcctg
cgcggccggctcggctttaccggcgcgatcttcagcgacgatctgtcgatggaagccgcg
cgcgagggcggcacgctgacgcaggccgccgacgcggcgctcgccgccggctgcgacatg
gtgctcgtgtgcaatcagccggaagcggccgaagtggtcctgaacgagctgaaggccgag
cgcaatgccgattccgcacggcgcatcaagcggatgcgcgcacgcggcaaggcgctcaag
tgggacaagctgatcgagcagcccgagtatcggcgcgcgcaggcgctgctggccgacgcg
ctccgataa

DBGET integrated database retrieval system