KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2309Help
Entry
Bmul_2309         CDS       T00624                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Bmul_2309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2523782..2524246)
Genome map
AA seq 154 aa AA seqDB search
MIAVPQAAIELAKRFEGFHRVPKHDPNRAYPYICPAGYWTIGYGHLCDPKHPPITETDAE
RYLAADLMTALNATLRYCPVLATEPEKRLAAIVDFTFNLGAGRLQTSTLRRRINQRDWHS
AGQELRRWVYGGGKVLPGLVTRREAEATCLLRAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcggtaccccaagcggccatcgagctggccaaacgcttcgagggcttccaccgc
gttccaaagcacgatcccaaccgcgcctatccgtacatctgtccggccggctactggacc
atcggctacggccacctctgcgatccgaagcacccaccgatcacggagaccgacgcagag
cgctacctggctgccgacctcatgacggcattgaacgcgacgctgcgctactgcccggtg
ctggccaccgagccagaaaagcgactcgcggccatcgtcgacttcaccttcaacctcggc
gcggggcgacttcaaacgtcgacgctgcggcggcggataaaccagcgggactggcatagt
gcgggccaagagctgcggcgctgggtgtatggcggtggcaaggtactgccggggcttgtc
acgcggcgagaggccgaggcgacttgcctgctccgcgccgcctga

DBGET integrated database retrieval system