KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2433Help
Entry
Bmul_2433         CDS       T00624                                 

Definition
bifunctional glucokinase/RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bmu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bmu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmu00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bmu00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2647497..2649425
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAVVAGQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTLTDAIR
KYLKDVKISRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGIEIIYRALAARDKKRVAANVDTAEVVERAHA
GDALALETVECFCGILGSFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFTHYLQNIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLEVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDILAVGVAIRRAS
PNDALPEALAQAKARANDEETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggccgtcgtcgcgggccagcatgccgacggcccgcgc
ctgctcgcggacgtcggcggcaccaacgcgcgcttcgcgctggagaccgggccgggcgag
atcacgcagatccgcgtgtatcccggcgccgattacccgacgctcaccgatgcgatccgc
aaatacctgaaggacgtgaagatcagccgcgtgaaccatgcggcgatcgcgatcgcgaat
ccggtcgacggcgatcaggtgacgatgacgaaccacgactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgacttcacggcgctcgcg
atggcgctgccgggcctgaccgacgcgcagcgcgtgcagatcggcggcggcacgcgccgc
cagaacagcgtgatcgggctgctcgggcccggcacggggctcggcgtatcgggcctgatt
cctgccgacgatcgctggatcgcgctcggcagcgaaggcggccacgcatcgttcgccccg
caggacgaacgcgaggatctcgtgctgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgagcgcgtctgcgcggggcccggcatcgagatcatctatcgcgcgctcgccgcgcgc
gacaagaagcgcgtcgccgcgaacgtcgataccgccgaagtcgtcgagcgcgcgcatgcg
ggcgatgcgctcgcgctcgagacggtcgaatgcttctgcggcatcctcggctcgttcgcg
ggcagcgtcgcgctgacgctcggcgcgctcggcggcgtctatatcggcggcggcgtcgcg
ctgaagctcggcgaactgttcacgcgctcgtcgttccgcgcgcgcttcgaggcgaagggc
cgcttcacgcactatctgcagaacatcccgacctacctgatcaccgccgaatatccggcg
ttcctcggcgtgtcggcgattctcgcggagcagctgtcgaaccgctcgggcggcgcatcg
tcggccgtgttcgagcggatccgccagatgcgcgacgcgctgacgccggccgaacgccgc
gtcgccgatctcgcgctgaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagccgaccgtgatccgcttctgccgctcgctcggctgc
caggggctatccgacttcaagctgaagctcgcgaccgggctcaccggcacgattccgatg
agccacagccaggtgcatctcggcgacacggcgaccgacttcggcgcgaaggtgctcgac
aacacggtgtccgcgatcctgcagctgcgcgagcatctgaatttcgagcatgtcgagaac
gcaatcgagatcctgaacggcgcgcgccgcatcgagttctacgggctcggcaactcgaac
atcgtcgcgcaggacgcgcattacaagttcttccgcttcggcattccgacgatcgcgtac
ggcgacctgtacatgcaggctgcctccgcggcgctgctcggcaagggcgacgtgatcgtc
gcggtatcgaaatcgggacgcgcgcccgagctgctgcgcgtgctcgaggtggcgatgcag
gcgggcgcgaaggtgatcgcgatcacgtcgagcaatacgccgctcgcgaagcgcgcgacc
gtcgcgctcgagaccgatcacatcgagatgcgcgagtcgcagctgtcgatgatctcgcgg
atcctgcatctgctgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgcatcg
ccgaacgacgcgctacccgaagcgctcgcgcaggcgaaggcgcgcgcgaacgacgaggaa
acggccgacgtgctcgactggctcagccacggcgcgtcgccggccgcgaaggacgtcgcg
cgcgactga

DBGET integrated database retrieval system