KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2497Help
Entry
Bmul_2497         CDS       T00624                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_2497
   00030 Pentose phosphate pathway
    Bmul_2497
   00051 Fructose and mannose metabolism
    Bmul_2497
   00052 Galactose metabolism
    Bmul_2497
   00500 Starch and sucrose metabolism
    Bmul_2497
   00520 Amino sugar and nucleotide sugar metabolism
    Bmul_2497
  Nucleotide metabolism
   00230 Purine metabolism
    Bmul_2497
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bmul_2497
Enzymes [BR:bmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bmul_2497
    5.4.2.8  phosphomannomutase
     Bmul_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2711480..2712937)
Genome map
AA seq 485 aa AA seqDB search
MRRHRREAARLFSMHATERESMISQSIFKAYDIRGVVGKTLDADTARSIGRAFGSEVRAQ
GGDAVVVARDGRLSGPELVGALADGLRAAGVDVVDIGMVPTPVGYFAASVPLALKGGERR
VDSCIVVTGSHNPPDYNGFKMVLRGAAIYGEQIQALYRRIVDERFESGSGTYEEHDVADA
YIDRIVGDVKLARPLKLVVDAGNGVAGPLATRLFKALGCTLVERFTDIDGTFPNHHPDPA
HPENLQDVIQALKDTDAELGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGA
QIIYDVKCTRHLAQWVKSKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYG
FDDGLYTGARLLEILAKTADPSAVLNALPDAMSTPELQLKLEEGENFSLIEKLQKEAKFD
GADEVVTIDGLRVEYPDGFGLARSSNTTPVVVLRFEAETQDGLKRIQDDFRRVLTAAKPD
VKLPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggcaccggcgagaggccgccagactattttccatgcacgcaaccgagagagaa
tcgatgatctcccaatccatcttcaaggcatatgacatccgcggcgtggtcggcaagacg
ctcgacgccgacacggcgcgcagcatcggccgcgcgttcggcagcgaagtgcgcgcgcag
ggcggcgacgcggtcgtcgtcgcgcgcgacggccgcctgtccgggcccgagctcgtcggc
gcgctcgccgacgggctgcgtgcggcaggcgtcgacgtcgtcgacatcggcatggtcccg
acgccggtcggctacttcgcggcgagcgtgccgctcgcgctgaagggcggcgagcgccgc
gtcgattcgtgcatcgtcgtcaccggcagccacaacccgcccgactacaacggcttcaag
atggtgctgcgcggcgcggcgatctacggcgagcagatccaggcgctgtatcgccgcatc
gtcgacgagcgcttcgagagcggcagcggcacgtacgaagagcacgacgtggccgacgcg
tacatcgaccgcatcgtcggcgacgtgaagctcgcgcgcccgctgaagctcgtcgtcgac
gcgggcaacggcgttgccggtccgcttgcgacgcgcctgttcaaggcgctcggctgcacg
ctggtcgagcgcttcaccgacatcgacggcacgttcccgaaccatcaccccgatccggcc
cacccggaaaacctgcaggacgtgatccaggcgctgaaggacacggacgccgagctcggc
ttcgcgttcgacggcgacggcgaccgtctcggcgtcgtcacgaaggacggccagatcatc
tatccggatcgccagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcg
cagatcatctacgacgtgaagtgcacgcgccacctcgcgcaatgggtgaagtcgaagggc
ggcgagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgaaacg
ggcgcgccgctcgcgggcgaaatgagcggccacgtgttcttcaaggatcgctggtacggc
ttcgacgacggcctctacacgggcgcgcgcctgctcgagatcctcgcgaagacggccgac
ccgagcgccgtgctgaacgcgctgcccgatgcgatgagcacgccggaactgcagctgaag
ctcgaggaaggcgagaacttcagcctgatcgagaagctgcagaaggaagcgaagttcgac
ggcgcggacgaagtcgtgacgatcgacggcctgcgtgtcgagtatccggacggcttcggg
ctcgcgcgttcgtcgaacacgacgccggtcgtcgtgctgcgcttcgaggccgagacgcag
gacggcctgaagcgcattcaggacgacttccgccgtgtgctgacggccgcgaagccggac
gtgaagctgccgttctga

DBGET integrated database retrieval system