KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2753Help
Entry
Bmul_2753         CDS       T00624                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Bmul_2753
Messenger RNA biogenesis [BR:bmu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Bmul_2753
Transfer RNA biogenesis [BR:bmu03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Bmul_2753
 Prokaryotic Type
    Bmul_2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3004652..3005083)
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYARQTVSADVAAGGFDTIPTARLPRE
AVTTLGLIAAGGPYPYEKDGIVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRIDNCYYTDDHYNSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatgttcgcgatg
ggtatcgtcggcacgccgacgggcagtctggtttccgccgcctacgcacggcagaccgtt
tcggccgatgtggccgccggcgggttcgatacgatcccgaccgcccgtctgccgcgcgag
gccgtgaccacgctcggcctgatcgctgccggcggtccctatccgtacgagaaagacggc
atcgtgttcggcaaccgcgagcggatcctgccgaaggcgaagcgcggctactaccacgag
tacacggtgccgacgccgcgcgcgcgcaatcgcggcgcgcgccggatcgtctgcggcggg
ccattgcggcggatcgacaactgttattacacggacgaccactacaacagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system