KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2841Help
Entry
Bmul_2841         CDS       T00624                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bmul_2841
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bmul_2841
Enzymes [BR:bmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Bmul_2841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
1:complement(3096207..3097748)
Genome map
AA seq 513 aa AA seqDB search
MSAARSSHPAHQQIAAALAWLRQHVAPAAQLHADTRSLRAGDVFVAYAVDGADNRAFIAD
ALARGAAAVLYQPEGLAATPNAPVALAVPALDQLAGEIASGWYGDPSDGLLAIGVTGTNG
KTSCTQWIAAALTALHQPCAIIGTLGSGMPGHLVPTGFTTPDAPQLQRSLAQLRDGGAQA
VAMEVSSHALHQGRVNGTAFDIAVFTNLTQDHLDYHRTFEAYEAAKAKLFAWRGLRAAVV
NRDDAAGRRLLEKLAGRVRTIAYGIGDAQQAPDADRELVAIDVRATATGTAFRLRSSWGD
ADVEVGTLGTFNVSNLLAVLGALLAADVPFDAALAEIARLEPVNGRMQRLGGRLQNDEPL
VVIDYAHTPDALEKTLDALRPIAVARGGRLICMFGCGGDRDATKRPLMGAIAERLADDVV
VTSDNPRSEDPQAIIDQIVAGMTAPDRARRIEDRASAILQAVRGAAREDVVVLAGKGHEA
TQEIMGKKRAFSDQDHARLALAARATHGKGGGE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgctcgcagttcccatccggcgcatcagcaaatcgcagccgcgcttgcgtgg
ctgcgtcagcatgtagcccccgccgcgcaactgcatgcggacacgcgcagccttcgggcc
ggcgacgtgttcgtcgcctatgcggtcgacggggccgacaatcgcgcattcattgccgac
gcgctcgcgcgcggcgcggccgccgtgctgtatcagcccgaaggactcgccgccacgccg
aacgcgcccgtcgcgctcgcggtgccggcgctcgaccagctcgccggcgagattgcgagc
ggctggtacggcgatccgagcgacggcctgctcgcgatcggcgtgaccggcacgaacggc
aagacgtcgtgcacgcagtggatcgccgccgcgctgacggcgctgcaccagccgtgcgcc
atcatcggcacgctcggcagcggaatgccgggccacctcgtgccgaccggcttcacgacg
cccgatgcgccgcagctgcagcgcagcctcgcgcagctgcgcgacggcggcgcgcaggcg
gtcgcgatggaagtgtcgtcgcacgcgctgcatcaggggcgcgtgaacggcacggcgttc
gacatcgccgtcttcacgaatctgacgcaggatcacctcgactatcaccgcacgttcgaa
gcgtacgaagccgcgaaggcgaagctgttcgcctggcgcggactgcgtgcggcggtcgtg
aaccgcgacgacgcggccggccgccgcctgctcgaaaaactcgcgggccgcgtgcgcacg
atcgcgtacggaatcggcgatgcgcagcaggcgcccgacgccgatcgcgaactggtcgcg
atcgatgtgcgcgcgaccgcgaccggcacggcattccgtctgcgttcgtcgtggggcgac
gcggacgtcgaggtcggcacgctcggcacgttcaatgtcagcaacctgctcgccgtgctc
ggcgcgctgctcgccgccgacgtgccgttcgacgcggcgcttgccgagatcgcgcggctc
gagcccgtcaacggccggatgcagcgtctcggcggccggctgcagaacgacgagccgctc
gtcgtgatcgattacgcacatacgcccgacgcgctcgagaagacgctcgacgcgctgcgc
ccgatcgccgtcgcgcgcggcggccggctgatctgcatgttcggctgcggcggcgatcgc
gatgcgaccaagcgtcccctgatgggcgcgatcgccgaacggctcgccgacgacgtcgtc
gtcacgagcgacaacccgcgcagcgaggatccgcaagcgatcatcgatcagatcgtcgcc
ggcatgacggcgcccgatcgcgcgcgccgcatcgaggatcgcgcgagcgcgatcctgcag
gccgtgcgcggcgcggcgcgcgaggacgtcgtcgtgctcgccggcaagggacacgaggca
acgcaggaaatcatgggcaagaagcgcgcattctccgaccaggaccacgcgcggctcgcg
ctcgcggcgcgcgcgacgcacggcaagggaggcggcgaatga

DBGET integrated database retrieval system