KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2863Help
Entry
Bmul_2863         CDS       T00624                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01130  Biosynthesis of antibiotics
bmu01230  Biosynthesis of amino acids
Module
bmu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bmul_2863
Enzymes [BR:bmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bmul_2863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABX16547
UniProt: A9AJ43
Position
1:3127648..3128433
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEVAAAMRSTPLEALKLEASARDRRDFVGALRAKHAAGQPAVIAEIK
KASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGSVRYLEEARAACDLPVLRK
DFIVDAYQILEARAMGADAILLIAAALDTPLMQELEAYAHSLDLAVLVEVHDRNEMEQAL
TLKTPLLGINNRNLRTFETSIRATLDMLDMIPQDRIVVTESGILSRADVDTMRAANVNTF
LVGEAFMRADQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgcgaagaagtagccgccgccatg
cgcagcacgccgctcgaggcgctgaagctggaagcgtccgcacgcgaccggcgcgacttc
gtcggcgcgctgcgcgccaagcatgcggccggccagccggccgtgatcgccgaaatcaag
aaggcgagcccgtcgaagggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgc
tcgtacgcggcgcacggcgccgcgtgcctgtcggtgctgaccgacgagcagttcttccag
ggcagcgtccgctatctcgaggaagcgcgcgccgcgtgcgacctgccggtgctgcgcaag
gacttcatcgtcgacgcgtaccagatcctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgccgcgctcgacacgccgctgatgcaggagctcgaagcgtatgcgcac
tcgctcgatctcgcggtgctcgtcgaagtgcacgaccgcaacgaaatggagcaggcgctg
acgctcaagacgccgctgctcggcatcaacaaccgcaacctgcgcacgttcgaaacctcg
atccgggcgacgctcgacatgctcgacatgattccgcaggaccgcatcgtcgtgaccgaa
tcggggatcctgtcgcgcgcggacgtcgatacgatgcgcgcggcgaacgtcaacacgttc
ctcgtcggcgaggcgttcatgcgtgccgaccagccgggcgaggaactcgcacggatgttc
ttctga

DBGET integrated database retrieval system