KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_2868Help
Entry
Bmul_2868         CDS       T00624                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Brite
Enzymes [BR:bmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Bmul_2868
Secretion system [BR:bmu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bmul_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3132772..3133500)
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIASLALAVTMAALGCTAQADQTTDKLKATLQARLGNDAPIKSVSKSPVAGLYEV
NLGSQIIYSDAAGDYVLLGDLVDAKTHKNLTDARLSELNKIDFTSLPFANAIKVVKGNGA
RKIAVFSDPNCPYCKRLETTLQSVDNVTVYTFLYPVLSPDSTAKSKAIWCATDRAKTWQS
WMLDHRAPSGAGNCDTSALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
SK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgatccgcatcgcctcgctggcgctggccgtcacgatggcggcgctcggc
tgcaccgcgcaggccgatcagaccaccgacaagctgaaagccacgctgcaagcgcgtctc
ggcaacgacgcaccgatcaagagcgtgtcgaaatcgccggtcgcggggctgtacgaagtg
aacctcggctcgcagatcatctatagcgatgcggcgggcgactacgtgctgctcggcgat
ctggtcgacgcgaagacgcacaagaacctcaccgacgcacgcctgtcggagctcaacaag
atcgacttcacgagcctgccgttcgccaacgcgatcaaggtcgtgaagggcaacggcgcg
cgcaagatcgccgtgttctccgatccgaactgcccatattgcaagcgtctcgaaaccacg
ctgcagtcggtcgataacgtcaccgtctacacgttcctgtatccggtgctgtcgcccgat
tcgaccgcgaagtcgaaggcgatctggtgcgcgaccgatcgcgcgaagacgtggcagagc
tggatgctcgatcatcgtgcgccgtccggcgccggcaactgcgacacgagcgcgctcgac
aagaatctcgcgctcggccgcggcatgaacgtgacgggcacgccgacgatcttcctgccg
gacggccgccgcctgccgggcgcggtgtcggccgaccagctgaaccaggcgctcgcgtcg
agcaagtaa

DBGET integrated database retrieval system