KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3189Help
Entry
Bmul_3189         CDS       T00624                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmul_3189
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bmul_3189
   00630 Glyoxylate and dicarboxylate metabolism
    Bmul_3189
Enzymes [BR:bmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bmul_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(48445..50619)
Genome map
AA seq 724 aa AA seqDB search
MIDHDGLQVAPALSQFIENEALPGTGIDQAAFWRGFSALVHDLAPRNRELLAERDRLQSE
LDAWHRAHPGPVRDLAAYRAFLEQIGYLVPTPADVAATTANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDNGAERTATYNPTRGQRVIDYARNVLDNAAPLA
GASHRDALRYRVQDGQLAVETGKGIVHLAQPAQFVGYQGAADAPSAILLKHNGLHLEIQI
DGSTPIGRADVANVKDVVLEAAVSTIIDCEDSVAAVDAEDKVQLYRNWLGLMQGTLVEEV
SKGGKTFTRRLNADREYTTPDGGTLTLHGRSLLFVRNVGHLMTIGAVLDRDGNEIPEGIL
DGVVTTLCALHDLKSKRNSRTGSIYIVKPKMHGPAEVAFADTLFARIEDLYGLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHSAMEAGPMIRKGDMKSSAWI
AAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELERTPYASERDALLDGLLTVPVVERAAWSDEEILREVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPDYDRSVAFQAACALALHGTSQPSGYTEPLLHRFRLAFKAQ
QAQA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccatgacggactgcaagtcgcgccagcgctgagccagttcatcgaaaacgaa
gcgctgccgggcaccggcatcgaccaagccgcgttctggcgcggcttctccgcactggtg
cacgaccttgcgccgcgcaaccgcgaactgctcgccgagcgcgaccgtctgcaaagcgaa
ctcgacgcctggcatcgcgcgcaccccggcccggtgcgcgacctcgccgcgtatcgcgcg
ttcctcgagcagatcggctacctggtgccgacgccggccgacgtcgcggccacgaccgcg
aacgtcgacagcgaaatcgcgacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgcggcgaacgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgccggaagacaacggcgccgagcgcaccgcaacgtacaacccgacg
cgcggccagcgcgtgatcgactacgcgcgcaacgtgctcgacaacgcggcgccgctggcc
ggtgcgtcgcaccgcgacgcgctgcgctaccgcgtgcaggacggccagctcgccgtcgag
accggcaagggcatcgtgcacctcgcgcagcccgcgcaattcgtcggctaccagggcgcg
gccgatgcgccctccgcgatcctgctgaagcacaacgggctccatctcgagatccagatc
gacggctcgacgccgatcggccgcgcggacgtcgcgaacgtgaaggacgtcgtgctcgaa
gcggcggtcagcacgatcatcgactgcgaggattcggtcgcggccgtcgacgccgaggac
aaggtgcagctgtaccgcaactggctcgggctgatgcagggcacgctggtggaggaagtg
tcgaagggcggcaagacgttcacgcgccgcctgaacgcggaccgcgaatacacgacgccc
gacggcggcacgctgacgctgcacggccgctcgctgctgttcgtgcgcaacgtcgggcac
ctgatgacgatcggcgcggtgctcgatcgcgacggcaacgagattccggaaggcatcctc
gatggcgtcgtcacgacactctgcgcgctgcacgacctgaagtcgaagcgcaattcgcgc
accggctccatctacatcgtgaagccgaagatgcacggcccggccgaagtcgcgttcgcc
gatacgctattcgcgcgcatcgaggatctctacgggctgccgcgcaatacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcctgcatcgcggccgcc
gccgcgcgcgtcgcattcatcaacacgggcttcctcgatcgcaccggcgacgagatgcac
agcgcgatggaagcgggaccgatgatccgcaagggcgacatgaagtcgtccgcatggatc
gccgcgtacgagcgcaacaacgtgctcgccgggctgtcggccggactgcgtgggcgcgcg
cagatcggcaaggggatgtgggcgatgcccgacctgatgcacgcgatgctcgagcagaag
atcgcgcatccgcgcgcgggcgcgaacaccgcgtgggtgccctcgccgaccgccgcgacg
ctgcatgcgctgcactaccatctcgtcgacgtgcaggccgtccagcaggaactcgaaagg
acgccgtacgcgagcgagcgcgacgcgctgctcgacgggctgctgaccgtgccggtcgtc
gagcgtgccgcgtggagcgacgaagagatcctgcgcgaagtcgaaaacaacgcgcagggc
attctcggctacgtcgtgcggtgggtcgaacagggcgtcggctgctcgaaggtgccggac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgtcacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgcgggcgacccgaactatcgtccgatggcgccc
gactacgaccggtcggtcgcgttccaggctgcctgcgcgctcgcgctgcacggcacgtcg
cagccgagcggctatacggagccgctgctgcaccggttccggcttgcgttcaaggcgcag
caggcacaggcctaa

DBGET integrated database retrieval system