KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3193Help
Entry
Bmul_3193         CDS       T00624                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bmu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(54294..58436)
Genome map
AA seq 1380 aa AA seqDB search
MARQEPTDRERLPASATLRSDLTFPIVGIGASAGGTTALQTFFENAPTGMEMAFVVIVHL
APEQISHMDSVLQHTTGMPVRQVTSTVPIEKNHIYVIAPGMQLEMADGCLRCSPREMSGG
VALTIDHFFRTLADAHDSRAIGIVMSGTGSDGAAGLRRIKEVGGITLAQTPDDAEHAEMP
KQAIAVGGADIVLPAAEMPQRLLDLWANARRIEQQGLELAHAHQNLDRPGANDPERALSD
ILMHLRVRTGHDFRLYKRATVLRRIERRMQVNGQRDLLAYRDFLRATPDEANALLADMLI
GVTQFFRDRDAFDFLEREVIASMFSPDAGEEQVRVWVAGCATGEEAYSISLLLARARETA
VSSQAIQVFATDIDEAAIVRARTGSYPLSIAADVPEPLLQRYFTRDGAHFVIAKSVRERI
LFAAHSLLRDPPFSHLDLISCRNVLIYLERAVQRQILELFHFALRPNGYLFLGTAESADA
ADDLFTVVDKKRRIYQARVVTHRAKTPTGCPPLLHVESGSADERPVPTPALRAPASPVQR
NFSYAELHQRALEMYSPPSVIIDKESNVVHLSDNAGRFLRHVGGELSSNIMTLVLPDLRL
DLRTAIFRALQTGTSVEARRVKWTHDTQVSWINMTVRPFHDKVANADFLLVVFDEVAGRM
TDEDQAEATGQDPVLAQLEHELQHSREQLATIIEQYETSVEELKASNEELQAINEELRST
SEELESSKEELQSVNEELTTANAEMQARIEDTAKANDDLHNIIASSEIATVFVDKEIRIK
RFTPNATAIFNLIDSDLGRSLFHITHSLRYPTLADDVRQSFQSLRLIEREIESEAGRWYL
IRLLPYRTADDHIDGAVITLIDVTDRHHAEEAARAGEQRLRLVAQSTKDYAIIIQDGNGI
IASWNAGAERIFGYTEDEMIGQDVELIYEPNDRHARVPAHEREVAAREGRADDERWHRTK
DGRRIFCSGVVTPIADTSFNGFAKIVRDLTQRKLSEDANREALAREQAAREQALSSNQLK
DEFIAVLSHELRHPLNLIGVRAEMLPRLPETRDIPAVREAAELIRQAVRAQAQIIDDLLD
LSRIRTGKLALELSRVDLTAVLRTIVDTCEADAHARGLVLTAELPDEPAIALADPIRCEQ
IFWNLMSNALKFTHAGGRIVVRLTHEARMLRVDVIDDGQGIDRDTLPHVFDMFRQAPRDR
TRGGLGIGLALVRQLVEMHDGRISAASEGPGRGTTMTVWLPAAADTRVAAADRRASEGRI
AGLHVLLVEDDAETALSLTTLLKLAGAEVRTAASGAAALEMLAQGPVDAIVSDIGLPDMD
GYALLRRIKADPQWAQVKAIALTGRNRQTDVGAATQAGFDTHLPKPLDFGLLLAALAEPR
NT seq 4143 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcaagagcctaccgatcgggagcggcttcccgcgtctgcgacgttgcgaagc
gatctgacgtttccgatcgtgggcatcggcgcatcggcaggcggcacgacggccttgcag
accttcttcgagaacgcgccgaccggcatggaaatggcgttcgtcgtcatcgtccatctg
gccccggagcagatcagccacatggacagcgtgctgcagcacacgaccggcatgccggtc
cgtcaggtgacgagcaccgtcccgatcgaaaagaaccatatctacgtgatcgcgcccggc
atgcagctcgaaatggcggacggctgcctgcgttgcagcccgcgcgagatgtcgggcggc
gtcgcgctgacgatcgaccactttttccggacgctggccgacgcgcacgattcgcgcgcg
atcggcatcgtgatgtccgggacgggctccgacggcgcggcggggctgcgccgcatcaag
gaagtcggcggcatcacgctcgcgcagacgcccgacgatgccgaacacgccgagatgccg
aagcaggcgattgcggtcggcggcgccgatatcgtgctgcccgccgccgaaatgccgcaa
cggctgctcgatctctgggccaacgcgcggcgcatcgaacaacaagggctcgaactcgcg
cacgcccatcagaatctcgaccggccgggtgccaacgaccccgaacgcgcgctgtcggac
atcctgatgcatttgcgcgtgcgcaccgggcacgacttccggctctacaagcgcgcgacc
gtgctgcgccggatcgaacggcgcatgcaggtcaacgggcagcgcgacctgctcgcgtac
cgcgatttcctgcgcgcgacacccgacgaggcgaacgcgctgctcgccgacatgctgatc
ggcgtcacgcagttcttccgcgatcgcgacgcgttcgacttcctcgaacgcgaggtgatc
gcgtcgatgttctcgccggatgccggcgaggaacaggtgcgcgtctgggtcgccggctgc
gcgacgggcgaggaggcgtattcgatctcgctgctgctcgcccgtgcgcgcgagacggcc
gtgtcgagccaggcgatccaggtgttcgcgaccgacatcgacgaagcggcgatcgtgcgc
gcgcgcaccggctcctatccgctgtcgatcgcagccgacgtgcccgaaccgctgctgcag
cggtatttcacgcgcgacggcgcgcatttcgtgattgcgaaatcggtgcgcgagcgcatt
ctgttcgccgcgcacagcctgctgcgcgatccgccgttctcgcatctcgatctgatctcg
tgccgcaacgtgctgatctacctcgaacgcgcggtgcagcggcagatcctcgagctgttt
cacttcgcgctgcgcccgaacggctatctgttcctcggcaccgccgaatcggccgacgcg
gccgacgatctgtttaccgtcgtcgacaagaagcgccgcatctatcaggcgcgcgtcgtc
acgcatcgcgcgaaaacgccgaccggttgcccgccgctgctgcacgtcgaatcgggttcg
gccgacgagcggcccgtgccgacgccggcgctgcgtgcgccggcgagcccggtccagcgc
aatttctcgtatgcggaactccatcaacgggcactggaaatgtattcgccgccgagcgtg
atcatcgacaaggaatcgaacgtcgtgcatctgtcggacaacgccggccgattcctgcgc
cacgtcggcggcgagctgtcgagcaacatcatgacgctcgtgctgcccgacctgcggctc
gacctgcgcaccgccatcttccgcgcgctgcagacgggcacgagcgtcgaggcgcgccgc
gtcaagtggacgcacgacacgcaggtgtcgtggatcaacatgacggtgcggccgtttcac
gacaaggttgcgaacgcggactttctgctcgtcgtgttcgacgaggtggccgggcgcatg
accgacgaggaccaggccgaagccaccgggcaggatccggtgctcgcgcagctcgagcac
gaactgcagcacagccgcgagcagctcgcgacgatcatcgagcagtatgaaacctcggtc
gaggaactgaaggcctcgaacgaggaactgcaggcgatcaacgaggagctgcgctcgacc
agcgaggagctcgaaagcagcaaggaagaactgcagtcggtgaacgaggagctgacgacc
gcgaacgccgagatgcaggcgcggatcgaggacaccgccaaggccaacgacgatctgcac
aacatcatcgcctcgagcgagatcgcgaccgtcttcgtcgacaaggaaatccgcatcaag
cgcttcacgccgaacgcgaccgcgatcttcaacctgatcgacagcgatctcggccgctcg
ctgtttcacatcacccattcgctgcgctatccgacgctcgccgacgacgtgcggcagtcg
ttccagtcgctgcggctgatcgaacgcgagatcgagagcgaggccgggcgctggtatctg
atccggttgctgccgtatcgcaccgccgacgaccatatcgacggcgccgtcatcacgctg
atcgacgtcacggatcgccatcacgcggaggaagccgcgcgggccggcgagcagcggctg
cgcctcgtcgcgcagtcgacgaaggactacgcgatcatcatccaggacggcaacggcatc
atcgcgagctggaatgcgggggccgaacggatcttcggctataccgaagacgaaatgatc
ggccaggacgtcgagctgatctacgagccgaacgaccggcatgcgcgcgtgccggcgcac
gagcgcgaggtcgcggcgcgcgaaggccgcgcggacgacgaacgctggcatcgcacgaag
gacgggcggcggatcttctgcagcggtgtcgtgacgccgattgccgatacgtcgttcaac
ggcttcgcgaagatcgtccgcgacctgacgcagcgcaagctcagcgaggacgcgaaccgc
gaagcgctcgcgcgcgagcaggccgcccgcgagcaggcgctcagttccaatcagctgaag
gacgagttcatcgccgtgctgtcgcacgaattgcggcatccgctgaacctgatcggcgtg
cgtgccgaaatgctgccgcgtctgcccgaaacgcgcgacatccccgcggtgcgcgaagcg
gccgagctgattcggcaggcggtacgcgcgcaggcgcagatcatcgacgatctgctcgat
ctgtcccgcatccgcaccggcaagctcgcgctcgagctgtcgcgcgtcgatctgacggcg
gtgctgcgcacgatcgtcgatacgtgcgaggcggacgcgcacgcgcgcggcctcgtgctg
accgccgagttgccggacgagccggcgattgcgctcgccgatccgatccgctgcgagcag
attttctggaacctgatgtcgaatgcgctgaagttcacgcatgcaggcggccggatcgtc
gtgcggctcacgcatgaagcgcggatgctgcgcgtcgacgtgatcgacgacggacaggga
atcgaccgcgacacgcttccgcacgtgttcgacatgttccgccaggcgccgcgcgaccgc
acgcgcggcgggctcggcatcgggctcgcgctcgtgcggcagctcgtcgaaatgcacgac
ggccgcatttcggcggcgtccgaggggcccgggcgcggcaccacgatgacggtgtggctg
ccggccgccgccgacacgcgcgtcgcggccgccgaccgccgcgcgtcggagggccgtatc
gcgggcctgcacgtgctgctcgtcgaggacgacgccgagaccgcgctgtcgctgactacc
ctgctgaaactggcgggcgcggaggtgcgcaccgcggcgagcggcgcagcggcgctggag
atgctcgcgcaaggccccgtcgatgcgatcgtgtccgatatcgggctgcccgacatggac
ggttacgcgctgctgcgccgaatcaaggccgatccgcaatgggcgcaggtgaaggcgatc
gcgctgacgggccgtaaccgtcagaccgacgtcggcgccgcgacccaagccggattcgac
acgcatctgccgaaaccgctcgatttcggcttgttgctcgcggccctcgccgaaccgcgc
tga

DBGET integrated database retrieval system