KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3197Help
Entry
Bmul_3197         CDS       T00624                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(61956..63941)
Genome map
AA seq 661 aa AA seqDB search
MRVGVCYYPEHWPESMWADDARRMKALGIAQVRIAEFAWSRIEPSPGEYDWGWLDRAVDV
LAAAGLDIVMCTPTATPPKWLIDRHPEILAIGADGRPRTFGSRRHYDFSSPVYYDASRQI
CTAVAERYGRHPAVRFWQTDNEMGCHQTVVSYSPAALARFREWLKARYGTIDALNRAWGT
VFWSMEYRDFDEIDAPVGTVTEAHPTHRLDYRRFASDEVVRYHRMQVDVIRAHSPGRPVA
HNFMQLFTDFDHYAVARDLDVATWDSYPLGALEEHWFAPDVKARWLRTGHPDFASFNHDL
YRGMSKLPFWVMEQQPGPVNWAHWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLHTPDDRLDEGGREAERVAHEIAVVHGADAHADAAVHARVALVFDYEAKWLLDV
QPQGADFQYARIAFEYYSALRALGLDVDVISAQAPLDGYRLVVVPPLPIVPDDFAARLAA
SGAHAVFGPRTGSKTVDLQIPPTLPPGALASILPLRVWRVESLRPNVTERVDGALVDGTP
FAGHARHWRDLVELRDAQRTVVRARFADDHPAWLSHGTLHYWAALFDDATTAQLFASVAA
EAGLAPTPLADGVRISRRGGLTYVFNYGDTVHTIDAVPPAAFVVGSADVEPRGVAVYRSP
V
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggcgtctgttactacccggaacactggccggaatcgatgtgggcggacgac
gcccgccggatgaaagcgctcggcatcgctcaggtgcgcatcgcggaattcgcgtggagc
cgcatcgagccgtcgcccggcgaatacgattggggctggctcgatcgcgcggtcgacgtg
ctcgccgcggccggcctcgacatcgtgatgtgcacgccgaccgcgacgccgccgaaatgg
ctgatcgaccgccatcccgagatcctcgcgatcggcgcggacggccggccgcgcacgttc
ggctcgcgccgccactacgacttctcgtcgccggtctattacgacgcgtcgcggcagatc
tgcacggcggtcgccgagcgctacggccgccatccggccgtgcgcttctggcagaccgac
aacgagatgggctgccaccagacggtcgtcagctattcgccggccgcgctcgcacgcttt
cgcgaatggctgaaggcgcgctacgggacgatcgacgcactgaaccgcgcgtggggcacc
gtgttctggagcatggagtatcgcgatttcgacgagatcgacgcgcccgtcggcaccgtg
accgaagcgcatccgacgcatcggctcgactaccggcgtttcgcgtcggacgaagtggtc
cgctatcaccggatgcaggtcgacgtgatccgcgcgcactcgccgggccggccggtcgcg
cacaacttcatgcagctgttcaccgacttcgatcactatgcggtcgcgcgcgatctcgac
gtcgcgacgtgggacagctatccgctcggcgcgctggaggaacactggttcgcgcccgac
gtgaaggcgcgctggctgcgcacgggccatccggatttcgcgtcgttcaatcacgacctc
tatcgcgggatgtcgaagctgccgttctgggtgatggagcagcagccgggccccgtgaac
tgggcgcactggaacccggcgccgctgccgggcatggtgcggctgtggagctgggaagcc
ttcgcgcacggcgcgggctgcgtgtcgtacttccgctggcggcaggcgccgttcgcgcag
gaacagatgcatgcgggcctgcacacgcccgacgaccggctcgacgaaggcggccgcgaa
gcagagcgcgtcgcgcacgagatcgccgtcgtgcacggcgccgatgcacacgcggacgcc
gccgtgcatgcgcgcgtcgcgctcgtcttcgactacgaagcgaagtggctgctcgacgtg
cagccgcaaggcgcggacttccagtacgcacgcatcgcgttcgagtactactcggcgctg
cgcgcgctcggcctcgacgtcgacgtgatctccgcgcaggcgccgctcgacggctatcgg
ctcgtcgtcgtgccgccgctgccgatcgttcccgacgatttcgccgcgcgcctcgccgca
tcgggcgcgcatgccgtgttcgggccgcgcaccggttcgaagacggtcgacctgcagatt
ccgccgacgctgccgcccggcgcactcgcctcgatcctgccgctgcgcgtgtggcgcgtc
gaatcgctgcggccgaacgtgaccgaacgcgtcgacggcgcgctcgtcgacggcacgccg
ttcgccggtcacgcgcgccactggcgcgacctcgtcgagctgcgcgatgcgcagcgcacc
gtcgtgcgcgcgcgctttgccgacgatcatccggcatggctgtcgcacggcacgctgcat
tactgggccgcgctgttcgacgacgcgaccaccgcgcagctgttcgcgagcgtcgccgcc
gaagcggggctcgcgccgacgccgctcgccgacggcgtgcgcatcagccggcgcggcggg
ctcacgtacgtcttcaactacggcgacaccgtgcacacgatcgatgccgtgccgccggcc
gcgttcgtggtcggcagcgcggacgtcgagccgcgcggcgtcgccgtctatcgcagcccg
gtgtag

DBGET integrated database retrieval system