KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3539Help
Entry
Bmul_3539         CDS       T00624                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmul_3539
  Energy metabolism
   00680 Methane metabolism
    Bmul_3539
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bmul_3539
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Bmul_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:471184..472380
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGKVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKIGDLVSVPFNVACGRCAMCKETHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHAKAMGFETVDLSKD
ATLGEQIAQILGKPEIDCAVDCVGFEAHGHGSSGHAEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAQDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILYDRLPIA
KIVNVTVISLDDAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggcaaggtcgaggtgcagaagatc
gattatccgaagatggtcgacccgagcggccgcgcaatcggacacggcgtgatcctgaag
gtcgtcagcacgaacatctgcggctcggaccagcacatggtgcgcggccgcacgacggcg
ccggtcggtctcgtgctcggtcacgagatcacgggcgaggtcgtcgaggtcggtcgcgac
gtcgagacgctgaagatcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggaaacgcatacgggcgtgtgcctgaacgtgaacccgtcgcgcgcg
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggccaggccgaatacgtg
ctcgtgccgtatgccgacttcaacctgctgaaattcccggaccgcgatcaggcgatggcg
aagatccgcgatctgacctgcctgtccgacattctgccgaccggttatcacggcgcggtc
agcgccggcgtgaagccgggctcgaccgtctacatcgcgggcgcgggcccggtcgggatg
gcggcggccgcctcggcgcgcctgctcggcgcggccgtgacgatcgtcggcgacatgaac
gcggaacgcctcgcgcatgcgaaggcgatgggcttcgagacggtcgacctgtcgaaggac
gcgacgctcggcgaacagatcgcgcagatcctcggcaagccggagatcgactgcgcggtc
gactgcgtcggcttcgaggcgcacggccacggctcgtcgggccatgcggaagaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcggccggccggtgcgatcggcattccg
ggcctgtacgtgacggacgatccgggcgcgcaggacaaggccgcgcagcacggcagcctg
agcatccgcttcggtctcggctgggcgaagtcacattcgttcttcacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgtacgaccgcctgccgatcgcg
aagatcgtcaacgtgacggtgatctcgctcgacgacgcgcccgaaggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtgatcgatccgcacgggctgctcgcggcctga

DBGET integrated database retrieval system