KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3676Help
Entry
Bmul_3676         CDS       T00624                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bmul_3676
   00330 Arginine and proline metabolism
    Bmul_3676
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bmul_3676
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Bmul_3676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(622394..623308)
Genome map
AA seq 304 aa AA seqDB search
MNYQPILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTVGDAQERFS
IQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVKAETALVEFVRRLIGANDIDYDSRVALSELQHAERNRAMAHFMASFGNMQMP
PETVVDAYCRQCAITMNCVELARAALFLANGGVAPATGERIVDPSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYSG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccaaccgattctcgaacgcatccataccgaactcgccccctggatcggccag
ggccgcgtggccgactacattcccgagctcgcgaaagtacccgccgacaagttcgggatg
gcggtcgtcacgctcgacggcaacgtttacacggtcggcgacgcgcaggagcgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagctgctcggcgacgcg
ctgtgggaacgcgtcggccgcgaaccgtccggcaccgcgttcaattcgctcgtgcagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaacgcgggcgcgctcgtcgtcacc
gacgtgctgtgccgccgcttcgtgaaggcggaaaccgcgctcgtcgaattcgtgcggcga
ctgatcggcgcgaacgacatcgactacgattcgcgcgtcgcgctgtcggagctgcagcac
gcggagcgcaatcgcgcgatggcgcatttcatggcgagcttcggcaacatgcagatgccg
ccggaaacggtcgtcgatgcgtattgccgtcagtgcgcgatcacgatgaactgcgtcgag
ctcgcgcgcgccgcgttgtttcttgcgaacgggggtgtggcgcctgcgaccggggagagg
atcgtcgatccgagttcggcgaaacggctgtcggcgctgatgctgacctgcggcacttat
gacgcggccggggatttcgtctatcgcgtcgggctgccggcgaagagcggcgtcggcggc
gggatcgttgcggtgctgcccggcgagatggcggtctgcgtgtgggcgccggggctcgat
gcgaacgggaattcgttggcagggacgttggcgttggagtggttgacgacttattcggga
aggtcgattttttga

DBGET integrated database retrieval system