KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_3751Help
Entry
Bmul_3751         CDS       T00624                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:716430..718397
Genome map
AA seq 655 aa AA seqDB search
MCGIDGFLNSVAFDEETARGTLARMTASLAHRGPDAQGLWVDPAAGIALGHRRLAIVDLS
VHGRQPMASACGRYVMVFNGEIYNHRELRAQLERVGRAPAWRGHSDTEVLLAAFAAWGVD
ATLRRATGMFALALWNRESRVLTLARDRIGEKPLYYGRIGDALVFASELKALRAYPGFDG
EIDRDALCLYLRHSAVPAPHTIYRGIRKLPPGSWIQFEHAQDTPRIRTYWALEHAIDAGH
HEPFAGTAAEAVDRLDTVLRQAVARQMEADVPLGAFLSGGVDSSTIVALMQAQSAAPVDT
FTIGFHEAGYDEAGYAKAVARHLGTRHTELYVTADHALDVVPKLPAIYDEPFSDASQIPT
FLVAELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWRKLHRVPAAVRTRIAGALHALRP
DHADQLAAVAQGAWGGGELRESATRIGDRLHKLGHVMTADSRIGLYRLLMSSVHHPERIA
LAGHEPPTPLDTVSAWPAHLSFAEQAMAIDTLTYLPTDILTKVDRAAMAVSLETRMPFLD
HHVVEFAWRLPASLRLPEGQSKALLRRLLDRYVPTELIDRPKQGFCAPIDHWLRGALRDW
ADALLQPSRLRDEGFFDAAAVERLWRQHQTGRMNWQHQLWTVLMFQAWLDAQRAA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgacggctttctgaatagcgtcgccttcgatgaggagacagcgcgcggc
acgctcgcgcggatgacggcgagcctcgcgcatcgcggaccggacgcacagggcttgtgg
gtcgatccggcggccggtatcgcgctcggtcaccggcggctcgcgatcgtcgacctgtcg
gtgcacggccggcagccgatggcgtcggcgtgcggccgctacgtgatggtcttcaacggc
gagatctacaaccaccgcgaactgcgcgcgcagctcgagcgcgtcggacgcgcgcccgcg
tggcgcggtcattccgacaccgaagtgctgctcgccgcgttcgccgcgtggggcgtcgac
gcgacgttgcggcgcgcgaccgggatgttcgcgctcgcgctgtggaaccgcgagtcgcgc
gtgctgacgctcgcgcgcgaccgcatcggcgagaaaccgctgtattacgggcggatcggc
gatgcgctcgtattcgcgtcggagctgaaggcgctgcgcgcctatccggggttcgacggc
gagatcgatcgcgacgcgctgtgcctgtatctgcggcattccgcggtgcccgcgccgcat
acgatctatcgcggcatccgcaagttgccgcccggcagctggatccagttcgagcatgcg
caggacacgccgcgaatccgcacgtactgggcgctcgagcacgccatcgatgccggccat
cacgagccgttcgcaggcaccgcggccgaggccgtcgaccggctcgacacggtgctgcgg
caggccgtcgcgcggcagatggaagccgacgtgccgctcggcgcgttcctgtcgggcggc
gtcgattcgtcgacgatcgtcgcgctgatgcaggcgcagtccgccgcgcccgtcgacacg
ttcacgatcggttttcacgaagcgggctacgacgaggccggctatgcgaaggccgtcgcg
cgccatctcggcacgcgccataccgagctgtacgtgacggccgatcatgcgctcgacgtc
gtgccgaagctgccggccatctacgacgagccgttctccgacgcgtcgcagattccgacc
ttcctcgtcgcggaactgacgcgccggcacgtgaaggtcagcctgtccggcgacggcggc
gacgagctgttcggcggctatacgcgctacttcctgacgccgcgcctctggcgcaagctg
catcgcgtgccggcggccgtgcgtacgcggatcgccggcgcgctgcacgcgctgcgaccc
gatcatgcggaccagctcgcggctgtcgcgcaaggcgcgtggggcggcggcgaactgcgc
gaatcggcgacgcgcatcggcgaccggctgcacaagctcggccacgtgatgacggccgac
agccggatcgggctgtaccggctgctgatgtcgtcggtccatcatccggagcgcatcgcg
ctcgccgggcacgagccgccgacgccgctcgatacggtatccgcatggcccgcgcatctg
agctttgccgagcaggcgatggcgatcgacacgctcacctatctgccgaccgacatcctg
acgaaggtcgaccgcgcggcgatggcggtcagcctcgaaacgcggatgccgttcctcgat
catcacgtcgtcgaattcgcgtggcggctgcccgcatcgctgcgcttgcccgaagggcag
tcgaaggcgctgctgcgccggctgctcgaccggtacgtgccgaccgagctgatcgaccgg
ccgaagcagggcttctgcgcgccgatcgatcactggctgcgcggcgcgctgcgcgactgg
gccgacgcgttgctgcagccgtcgcggctgcgcgacgagggcttcttcgacgcggccgcg
gtcgagcggctgtggcgccagcatcagacggggcgcatgaactggcagcatcagctgtgg
accgtgctgatgttccaggcgtggctcgacgcgcagcgcgccgcctga

DBGET integrated database retrieval system