KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4229Help
Entry
Bmul_4229         CDS       T00624                                 

Definition
3-phosphoshikimate 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bmul_4229
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bmul_4229
Enzymes [BR:bmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Bmul_4229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1264448..1265785
Genome map
AA seq 445 aa AA seqDB search
MGLRQPPIRPHIMSNLIVHGGTPLRGDIKPSANKNAVLPILCATLLTDQPLRLIGVPDIT
DVRKILDIFRTLGSDVSVDFTTGLLELHHRNTTFDPAVHRLPEAMRSSIMLIPPLLARFG
VARLENDVKGCTLGVREIDPHVEVFERFGAHIERTSDSLIVRADGPLTANDHWLDYASVT
TTENFALCATAANGTSTLMNAASEPHVQEFCQFLAMIGVAVEGIGTSRLCVTGGSKLGGG
EFRFAEDFHEIATFLALGAITGGDITVRNSSPEHFPLIDRTFAKFGVQVTHRDGWSRAER
DGPLRVRRPFTQNILTKVEAAPWPYLPVDLLPIFIALGVRAEGSAMFWNKVYDGALGWSG
ELSKFGAHVLLSDPHRLITFGGLQLTPARVESPYIIRVAIALLMVAASIEGRSEIMNALP
IRRAHPRFVENLRSVGANVEWTSSE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggcctacgtcagccaccgatacgcccccatatcatgtcgaatctcatcgtccacggc
ggcaccccgctgcgcggggacatcaagccgtccgcgaacaagaacgccgtcctgccgatc
ctctgcgcgaccctgctgaccgaccagccgctgcggctgatcggcgtgccggacatcacc
gacgtgcgcaagatcctcgatatcttccgcacgctcggcagcgacgtgtcggtcgatttc
acgaccggcctgctcgaactccatcaccgcaatacgaccttcgacccggccgtccatcgc
ctgcccgaggcgatgcgctcgtcgatcatgctgattccgccgctgctcgcgcgcttcggc
gtcgcgcggctcgagaacgacgtgaaaggctgcacgctcggcgtacgcgaaatcgatccg
cacgtcgaggtgttcgagcgcttcggcgcgcacatcgagcgcacgtccgattcgctgatc
gtccgcgccgacggcccgctgacggccaacgatcactggctcgactatgcgtccgtgacg
accaccgaaaacttcgcgctgtgcgcgacggcggcaaacggcacgtcgacgctgatgaac
gcggcgtccgagccgcacgtgcaggagttctgccagttcctcgcgatgatcggcgtcgcg
gtcgagggcatcggcacgtcgcggctctgcgtgacgggcggcagcaagctcggcggcggc
gagttccgcttcgccgaggatttccacgagatcgcaacgttcctcgcgctcggcgcgatc
accggcggcgacatcaccgtgcgtaactcgtcgcccgagcactttccgctgatcgaccgc
acattcgcgaagttcggcgttcaggtcacgcaccgcgacggctggtcgcgcgccgagcgc
gacggcccgctgcgcgtgcgccggccgttcacgcagaacatcctcaccaaggtcgaagcg
gcgccgtggccgtacctgccggtcgatctgctgccgatcttcatcgcgctcggcgtgcgc
gccgaaggcagcgcgatgttctggaacaaggtctacgacggcgcgctcggctggtccggc
gagttgtcgaagttcggcgcgcacgtgttgctgtcggatccgcaccggctgatcacgttc
ggcgggctgcaactgacgccggcgcgtgtcgaaagcccgtacatcatccgcgtcgcgatt
gcactgctgatggtcgccgcgagcatcgaaggccgctccgaaatcatgaacgcgctgccg
atccggcgcgcgcatccgcgtttcgtcgagaacctgcgctcggtcggcgcgaatgtggag
tggacgagcagcgagtaa

DBGET integrated database retrieval system