KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4273Help
Entry
Bmul_4273         CDS       T00624                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1311824..1313242
Genome map
AA seq 472 aa AA seqDB search
MTVRSAFPSPDTPGAAAPRAPFRFARRAALALGAAVIGYGAFAIAFPAHTPAAIGDVVAD
WTGANPHPIVLQRPPVQPLSAVAQLGRALFFDASLSASGKQSCASCHNPDHAYGPPNALD
VQPGGLAMTQHGYRPPPSLMYLYRQPNFSIGPDAGENDDAPSVAQQAAAAAGVVKAQKVA
GTSAAPQLVPQGGMFWDGRADTLQQQAFGPLLNPVEMANASVDEVAHKLSQSSHRTQFLQ
LFGPRVFDSPQLAVSEAMFAIARYQVEDPSFHPYNSKYDRWLEGRARLTQAELRGLRLFN
DPHKANCAGCHLSKPGADGLPPMFTDYQYEALAVPRNRQLAQNRDPAFYDLGVCGPFRED
LKDQTQYCGMFLTPTLRNAATRHVFFHNGVYHTLDQVMAFYNERSIAPQKFYARGADGKV
DQYDDIPPKYRANVDVTDAPFDRKPGDTPAMTAQDIKDIEAFLGTLTDEPAH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacagtccgttccgcgttcccgtctcccgatacgcccggcgccgccgcgccgcgcgcc
cctttccgcttcgcacgccgcgcggcgctcgcgctcggcgcggccgtcatcggctacggc
gccttcgcgatcgcgtttcccgcgcatacgccggccgcgatcggcgacgtcgtcgcggac
tggaccggcgcgaatccgcatccgatcgtgctgcagcggccgcccgtgcagccgctgtcc
gcggtcgcgcagctcggccgcgcgctgttcttcgatgcgtcgctgtcggcgtccggcaag
cagtcgtgtgcgtcgtgccacaaccccgatcacgcctacgggccgccgaacgcactggac
gtgcagccgggcggcctcgcgatgacgcagcacggttatcggccgccgccgtcgctgatg
tatctgtatcggcagccgaacttcagcatcggccccgatgccggcgaaaacgacgacgca
ccgagcgtcgcgcagcaggcggccgcggcggccggcgtcgtgaaggcgcagaaggtggcc
ggcacgtcggccgcaccgcagctcgtaccgcaagggggaatgttctgggacggccgcgcg
gacacgctgcagcagcaggcattcggtccgctgctgaaccccgtggagatggcgaatgcg
agcgtcgacgaggtcgcgcacaagctgtcgcagtcgtcgcaccggacgcagttcctgcag
ttgttcggcccgcgcgtgttcgacagcccgcagctcgcggtgtccgaagcgatgttcgcg
atcgcgcgctatcaggtcgaggatccgtcgttccatccgtacaacagcaagtacgaccgc
tggctcgagggccgcgcgcgcctcacgcaggcggagctgcgcgggctgcggctgttcaac
gatccgcacaaggccaactgcgcgggctgtcacctgtcgaagcccggcgccgacgggctg
ccgccgatgtttaccgactaccagtacgaagcgctcgccgtgccgcgcaatcggcagctc
gcgcaaaaccgcgatccggcgttctacgatctcggcgtgtgcggaccgttccgcgaggat
ctgaaggaccagacgcaatattgcgggatgttcctgacgccgacgctgcgcaacgcggcg
acacgccacgtgttcttccacaacggcgtctatcacacgctcgatcaggtgatggcgttc
tacaacgaacgcagcatcgcgccgcagaagttctatgcgcgcggcgcggacggcaaggtc
gaccaatacgacgacattccgccgaagtaccgcgcgaacgtcgacgtgaccgacgcgccg
ttcgatcgcaagccgggcgacacgcccgcgatgacggcgcaggacatcaaggacatcgag
gcgttcctcggcacgctgaccgacgagccggcgcactga

DBGET integrated database retrieval system