KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4471Help
Entry
Bmul_4471         CDS       T00624                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bmul_4471
Enzymes [BR:bmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bmul_4471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1546515..1548203
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLLSNELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAVVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTEPTNQSVRDFAFCSAADDRGLFGQKVLLQRVSSDAAAGTPHGRWIGLLNV
RGAGVERLKAMLATLQARADFDTLDIPALLNALIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPMSEPGAGNGGAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccggatgctg
ctgagcaacgaactcgaattcctgatggaagcccacaacggcctgtccgcacgcatcgtg
cgcgaagccggcttcaagggcatctgggcctccggcctcgcgatctccgcgcagttcggc
gtacgcgacaacaacgaggcaagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcagagcgaccccgacttctcg
atcgtcgcgcgcgtcgaagcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcctatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgaaatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatcggcgatgcaggccgtcgcccgcgag
atccacgaaagcgaaacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccgtttgcaggacgccgacgaatactcggcggccgagcgtatctacctgtcgtcgtca
tcgcgcgcgtcgaacgcggcggtcgtgctcgccgcgagccgcggcaaggggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgcccgttgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcacggcgtgaacgacatcaccgtcgtcggcggctatcgc
gccgatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgaacgccacgccgaaacg
ggcgagctcgcatcgctcgcctgcgcggccgagcgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgatctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctgaccgagccgaccaaccagagcgtgcgcgacttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaggtgctgctccagcgc
gtgtcgagcgatgccgccgccggcacgccgcacggccgctggatcggtctgctgaacgtg
cgcggcgccggtgtcgagcgtctgaaggcgatgctcgcgacgctgcaggcacgcgccgat
ttcgacacgctcgacatccccgcgctgctcaacgcgctgatcgccgccggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgc
gcgggcgacttcgcgcacggccagacgccgatgtccgagccgggcgccggcaacgggggc
gcacgatga

DBGET integrated database retrieval system