KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4534Help
Entry
Bmul_4534         CDS       T00624                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bmul_4534
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bmul_4534
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bmul_4534
Two-component system [BR:bmu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bmul_4534
Bacterial motility proteins [BR:bmu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bmul_4534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1622492..1623496
Genome map
AA seq 334 aa AA seqDB search
MNIGIVNDLPLAVEALRRVLARRPEHRVLWVATDGAQAVELCAAQPPDIVLMDLIMPKFD
GIEATRRIMRSARPCAILIVTSSIGANTWRVYEAMGAGALDAVDTPQLREGAAGDTADLL
LAKIDQIGRLLDAPGGVRAGCATHRAHGGPLVAIGASAGGPGALASILGSLPADFDAPIV
IVQHVDRAFAEGMAQWLDGQTPLAVRVAREGDRPQPGVALLAATDDHLRMTRAGTLAYTR
EPAATPYRPSVDVFFNSLTEHWSGNVIGVLLTGMGRDGAIGLKALRMKGYHTIAQDEATS
AVYGMPKAAATLGAARAILPLERIASELATLVRI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcggcatcgtcaacgacctgccgcttgccgtcgaggcactgcgccgcgtgctc
gcgcggcggcccgagcaccgcgtgctgtgggtcgcgaccgacggcgcgcaagccgtcgag
ctctgcgccgcgcagccgcccgacatcgtgctgatggatctgatcatgccgaagttcgac
gggatcgaggcgacgcggcgcatcatgcgttccgcgcgcccgtgcgcgatcctgatcgtc
acgagcagcatcggcgcgaacacctggcgcgtctacgaggcgatgggcgccggcgcgctc
gacgccgtcgatacgccgcagctgcgcgaaggcgcggccggcgacaccgccgatctgctg
ctcgcaaagatcgaccagatcggccgtctgctcgacgcgccgggcggcgtgcgcgccggc
tgcgcgacgcatcgcgcgcacggcggcccgctcgtcgcgatcggcgcgtcggccggcggc
ccgggcgcgctcgcgtcgattctcggcagcctgccggccgacttcgatgcgccgatcgtg
atcgtccagcacgtcgatcgcgcgttcgccgaaggcatggcgcaatggctcgacggtcag
acgccgctcgccgtgcgcgtcgcgcgcgaaggcgatcgcccgcagccgggcgtcgcgctg
ctcgccgcgacggacgatcatctgcggatgacgcgcgccggcacgctcgcgtatacgcgc
gaaccggccgcgacgccgtaccggccgtcggtcgacgtgttcttcaacagtctgaccgag
cactggtccggcaacgtgatcggcgtgctgctgacgggcatgggccgcgacggcgcgatc
gggctcaaggcgctgcggatgaagggctaccatacgatcgcgcaggacgaggcgacgagc
gccgtctacgggatgccgaaggcggccgcaacgctcggcgccgcgcgcgcgatcctgccg
ctcgagcgcatcgcgagcgaactcgcgacgctcgtgcgcatctga

DBGET integrated database retrieval system