KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4573Help
Entry
Bmul_4573         CDS       T00624                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bmul_4573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_4573
  Lipid metabolism
   00071 Fatty acid degradation
    Bmul_4573
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bmul_4573
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bmul_4573
   00626 Naphthalene degradation
    Bmul_4573
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bmul_4573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1666723..1667880)
Genome map
AA seq 385 aa AA seqDB search
MNPFQFRTVPTLIVEYGAARRLGALLRARFPTLARLCVVTDAFLHRSGVLAPALDSLAAH
GWQVTVIDDVIADPPERVVLDATARAVAADAQIVLGLGGGSSMDVAKLIAVLAPGRQPLA
DMYGVDKVDTERLPLVQMPTTAGTGSEVTAVSIVTVGEARKMGVVSPHLFADVAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSARLKNPVSDMLAVQALTLLSRNLLAACDDGHDRH
AREAMLVGAMFAGQAFANAPVAAVHALAYPVGGIFHVPHGLSNALVLPHVLRFNAEAAAS
QYAELAAIVTPSATGSDEAKTHALIDEIDRLIVATGIPRTLREVGIGEGDLPRMAADAML
QTRLLVNNPREVTEADALEIYRRAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttcaattccgcaccgtcccgacgctgatcgtcgaatacggcgccgcgcgc
cggctcggcgcgctgctgcgcgcgcgctttccgacgctcgcgcgcctgtgcgtggtgacc
gacgcgttcctgcaccgcagcggcgtgctcgcgcccgcgctcgacagcctcgccgcgcac
ggctggcaggtgaccgtgatcgacgacgtgatcgccgatccgcccgagcgcgtcgtgctc
gacgcgacggcgcgcgcggtcgcggccgatgcgcaaatcgtgctgggtctcggcggcggt
tcgtcgatggacgtcgcgaagctgatcgccgtgctcgcgccgggccggcagccgctcgcc
gacatgtacggcgtcgacaaggtcgacaccgagcggttgccgctcgtacagatgccgacg
acggcaggcaccggttcggaggtgacggccgtgtcgatcgtcacggtgggcgaggcgcgc
aagatgggcgtcgtgtcgccgcatctgttcgccgacgtcgcgattctcgacgccgagctg
acgctcgggctgccgcgcgcggcgacggccgcgaccggcatcgacgcgatggtgcatgcg
atcgaggcctacacgtccgcgcggctgaagaatccggtgtccgacatgctggccgtgcag
gcgctgacgctgctgtcgcgcaacctgctcgccgcatgcgacgacggccacgaccggcac
gcgcgggaagcgatgctggtcggcgcgatgttcgcaggtcaggcgttcgcgaacgcgccg
gtcgcggccgtgcatgcgctcgcgtatccggtcggcggtattttccacgtgccgcacggg
ctgtcgaacgcgctcgtgctgccgcatgtgctgcgcttcaacgcggaagcggccgcgtcg
cagtatgcggaactcgcggcgatcgtcacgccgtcggcgacgggtagcgacgaggcgaag
acgcacgcactgatcgacgagatcgaccggctgatcgtcgcgaccggcattccgcgtacg
ctgcgcgaggtcggcatcggcgaaggcgatctgccgcggatggccgcggacgcgatgctg
cagacgcgcctgctcgtcaacaatccgcgcgaagtgacggaggccgacgcgctcgagatc
tatcggcgcgcgtggtga

DBGET integrated database retrieval system