KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4620Help
Entry
Bmul_4620         CDS       T00624                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bmul_4620 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmul_4620 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bmul_4620 (trpA)
Enzymes [BR:bmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bmul_4620 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1724792..1725607)
Genome map
AA seq 271 aa AA seqDB search
MSRIQQTFAALAQQGRKGLIPFITAGDPDPAKTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQRSSERALARGVTLKHVLADVKRFRETNQTTPVVLMGYANPIERHGVDAFAADARA
AGVDGVLVVDYPPEEAAVFAEKMRAAGIDPIFLLAPTSTDARIAEVGKIASGYVYYVSLK
GVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQLL
ESAAPEGAVAALQAFIAELRAALDGAANTAR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtattcagcagaccttcgccgcactcgcccagcagggccgaaagggcctgatc
ccgttcatcacggccggcgacccggatcccgcgaaaacggtcgaattcatgcacgcgctc
gccgccggcggcgcggacgtcatcgagctcggcgtgccgttctcggacccgatggccgac
ggccccgtgatccagcgctcgtcggaacgcgcgctcgcgcgcggcgtcacgctcaagcac
gtgctcgccgacgtcaagcgctttcgcgagaccaatcagacgacgcccgtcgtgctgatg
ggctatgcgaaccccatcgagcggcacggcgtcgacgcgttcgcggccgatgcgcgcgcg
gcgggcgtcgacggcgtgctcgtcgtcgactatccgcccgaagaagcggccgtattcgcc
gagaaaatgcgtgcagccggcatcgacccgatcttcttgctcgcgccgacgtcgaccgac
gcgcgcatcgcggaagtgggcaagatcgcgagcggctacgtgtactacgtgtcgctgaag
ggcgtgaccggcgccggaaatctggatgtttcgagcattgcgggtaaaatcccggccatc
aagtcgcgcgtgccggttccggtgggcgtcggcttcggcatccgcgacgccgaaacggca
cgtgcggtggccgaggtgtcggacgccgtcgtgatcggcagccgcctcgttcagctgctc
gaaagcgctgcgccggaaggcgccgtcgccgcgctgcaggccttcattgccgagctgcgc
gccgcgctggacggcgcggcgaacacggcgcgataa

DBGET integrated database retrieval system