KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4622Help
Entry
Bmul_4622         CDS       T00624                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00260  Glycine, serine and threonine metabolism
bmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01130  Biosynthesis of antibiotics
bmu01230  Biosynthesis of amino acids
Module
bmu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmul_4622
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bmul_4622
Enzymes [BR:bmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bmul_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX18300
UniProt: A0A0H3KQ52
Position
2:complement(1726557..1727750)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRGAYAKYQNDPDFVAEFQRELKHFVGRPSP
IYHAQRWSDTLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDASVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgacgatcgcggccacttcggcccgtatggcggcgtgttcgtcgcc
gagacgctgattcacgcgctggacgagctgcgcggcgcgtacgcgaaataccagaacgac
cccgatttcgtcgccgaattccagcgcgaactgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgacacgctcggcggcgcgcagatctatctgaagcgc
gaagatttgaaccacacgggcgcgcacaagatcaacaacgtgatcggccaggcgctgctt
gcgaagcgcatgggcaagaagcgcgtaatcgccgagacgggcgccggccagcacggcgtc
gccaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggcgccgag
gacgtgcgccgccaggccgccaacgtgtaccggatgaagctgctcggcgcgaccgtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaggcgatgcgcgactgg
gtcacgaacatcgagaacacgttctacatcatcggcacggtcgcgggcccgcatccgtac
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaaggtgcagatgccc
gaactcgccgggcgccagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atggggatcttctatccgtacatcgacgacgcgtcggtgcagctgatcggcgtcgaagcc
gcgggcgacggcctcgacaccggccatcacgcagcctcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgcacctatctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggccggcctcgactatccgggcgtcggtcccgagcacgcatggctgaag
gacagcggtcgcgcgcagtacgtcgggatcaccgacgaagaggcgctgaaggcgttccac
gactgctgccggatcgagggcatcatccccgcgctcgagtcgagccacgcgatcgcgtat
ggcgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaatctgtcgggc
cgcggcgacaaggacatgcatacggtcgccgagcgatcgggcatcacgctctga

DBGET integrated database retrieval system