KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4696Help
Entry
Bmul_4696         CDS       T00624                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bmul_4696
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bmul_4696
Enzymes [BR:bmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Bmul_4696
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bmul_4696
Two-component system [BR:bmu02022]
 CheA family
  CheA-CheYBV
   Bmul_4696
Bacterial motility proteins [BR:bmu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bmul_4696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1806858..1810502
Genome map
AA seq 1214 aa AA seqDB search
MSEQLKLVVLGGSAGSLDPLRAIVAALPSDPGFAVLVITHLDPKEESRLPDILQADARMP
VEKLVHLRKIEHDRIYVLPENAGVIALDGHFRLTRRQAGLNLPIDGCLASLAQDPDVNGA
AVILSGTGRDGAGGLVDLKASGGFVIAQQPQTAIHHGMPTAAIDTGLVDEVLSLEDIAPC
LVRRFGDPARSAEAADAQTADDDALGTAISIVQQKTGINLAYVKDVNLRRRFLRRVLLQK
DRDVDAYLQLLRSDAREAEALRDDILIGVTAFFRDAEFVNVLRQSVIPALLELKHDPIRV
WVPACSTGEEVYTIATLLKEALDRDALHRRVQIFGTDINEASIEIARAGRYSLASVDDVP
EAFRERTFAATSGGYVVRKAIREMCVFARHNVLTHAPFSGMDLISCRNLLIYLRKEAQQH
VLEVLHYACRPDGFLLLGRAEAVSGADGFEHAGAPHLYRKVPAAKRQQGAFPIDALRPWA
SQGTAPPARRAQQADPVLEAANRTALERYAPPGFVVDDKGDVVHFRGDVSGFVAPASGEA
SLALPRLLQPELNVTVRTALIEAKRTGQPVRRERVALGDTHFALEVLPLAAEDLVPHYLV
TLERLPDDAPAPQNTNTGSPHSRVQELERTVTTLSDELEATQAQLKSVVAEFESANEELR
TANEEMLSTNEELQSANEELLLAKQELESANQELASLNDELKSRNEQLDRVNDDLSNLVE
GIPLPVVVLDRQLRLRHFSPQAQALFGLPDDSVGQPLAQLNSLFSAVDLERVVQSAVQGL
ADVEHEYQDSEGRWWLVNVRAYRTADDRIDGAVLAFQDIHQLKSALGTAQSAQLDAERAN
TAKDNFLALVSHELRAPLNVISSWAAVLMTASERGMPTDEQMSQRAVTTILRHCQLQAEL
IDDLLDVSRISSGRFSLDSKPVDFAAAVRTVVESHRPVAAKKEIMLATSGLQSQAVVSGD
ARRLQQVASNLIGNALKFTPQGGRVEVALTRLGALIELSVADNGIGVKPELLPRLFDRFM
QSDTSRTRQYGGLGLGLSIVKHLVTAHGGTVTASSEGEGRGTRLTVRIPLLQTAATEPGT
VATAPAESARLDGLSVLLVDDDVPAQEPLAHLLRGLGAQVQIASGAKEALACLAAGSFDI
LVSDLAMPGADGHALLRDVRSREGGRRRIYALALTGLASIHDRDAAIAAGFDDHLPKPVD
VKVLLEKLSLGRGR
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
ttgtcggagcagttgaagctcgtcgtgctgggaggatcggctggcagcctcgacccgttg
cgcgcgatcgtcgccgcgctgccgagcgatcccggcttcgccgtgctcgtcatcacgcac
ctggatccgaaggaggaaagccggctgcccgacatcctgcaagcggatgcgcgcatgccg
gtcgaaaaactcgtccatctgcgcaagatcgaacacgaccgcatctatgtgctgcctgaa
aacgcgggcgtgattgcactggacggccatttccgattgacgcgcagacaggccggcctc
aacttgccgatcgacgggtgcctggcgtcgctcgcgcaggatccggacgtcaacggcgcg
gcagtgatcctgtcgggcaccggccgggacggtgcaggcgggctggtggacctgaaggct
tccggcggcttcgtcatcgcacagcagccgcagacggctattcatcatggtatgccgacc
gcggcgatcgacacgggtctggtcgacgaagtgctgtcgctcgaggacatcgccccgtgc
ctggtgcggcgcttcggcgatcctgcccgcagcgccgaagcagccgatgcgcagacggcc
gacgacgacgcgctcggcacggccatctcgattgttcagcagaaaaccggcatcaacctc
gcctacgtcaaggatgtcaatctacgccgccgattcctgcgccgcgtgctgctgcagaag
gatcgggacgtggatgcgtacctgcagctgctgcgcagcgatgcgcgcgaagccgaggcg
ctgcgcgacgacatcctgatcggcgtgacggccttctttcgcgacgccgagttcgtcaac
gtgctgcgccaatcggtcattccggcgctgctggaactgaagcacgacccgatccgcgtc
tgggtgcccgcctgctcgacaggcgaggaggtctacaccatcgcgacgctgctgaaggag
gcactcgatcgcgacgcgctgcatcgccgcgtgcagatcttcggcaccgacatcaacgag
gcatcgatcgaaattgcgcgggccggccgctacagcctggcgtcggtcgacgacgtgccg
gaggcgtttcgcgaaagaacgttcgccgccacgtcgggcggctatgtggtgcgcaaggcg
attcgcgaaatgtgcgtgttcgcgcggcacaacgtgctgacccacgcgcccttctcgggc
atggacctcatcagctgccgcaacctgctgatctacctgcgcaaggaggcacaacagcac
gtgctcgaggtgttgcactacgcatgccggcccgacggatttctgctgctcggccgcgcc
gaggccgtatcgggcgccgacggattcgagcacgccggcgcgccgcacctgtaccgcaag
gtgccggcggccaagcggcagcaaggcgcgttcccgatcgacgcactgcgtccatgggcg
agccagggcaccgcgccgccggcacgccgcgcgcaacaggccgatcccgttctggaggcg
gccaatcgcacggcgctcgagcgctatgcaccgccgggtttcgtcgtcgacgacaagggc
gacgtcgtgcactttcgcggcgacgtgtcgggcttcgttgcgccggcgagcggcgaggcg
tcgctggctctgccgcgcctgctgcagcccgagctcaatgtcacggtgcgcaccgcgctg
atcgaggccaagcggacaggccaacccgtgcggcgcgagcgcgtcgcgctcggcgacacg
catttcgcgctggaagtcctgccgctcgccgccgaggacctggtgccgcactatctggtc
acgctcgaacgattgcccgacgacgcgcccgcgccgcagaacacgaatacgggctcgccg
cacagccgcgttcaggaactcgaacgcacggtcacgacgctgtccgacgaactcgaggcc
acgcaagcgcagctcaagtccgtcgtcgccgaattcgaatcggccaacgaggaactgcgc
acggccaacgaggagatgctcagcaccaacgaagagctgcaaagcgcgaacgaggaactg
ctgctggccaagcaggaactggaatcggccaaccaggagcttgcgtcgctgaacgacgag
ctgaaatcgcgcaacgagcaactcgaccgcgtcaacgacgacttgagcaatctggtcgaa
ggcatcccgctaccggtcgtcgtgctggaccggcagctgcgcctgcggcatttttcgccg
caggcgcaagcgctgttcgggttgccggacgacagtgtcggacaaccgctcgcgcagttg
aacagcctgttctcggcggtcgacctcgaacgcgtcgtgcagtcggccgtgcagggattg
gcggatgtcgagcacgagtatcaggacagcgaaggccgatggtggctcgtcaacgtgcgt
gcctatcgcacggccgacgaccgcatcgacggcgccgtactcgccttccaggacatccat
cagctcaaaagcgccctcggtaccgcacagtccgcgcaactcgatgcggaacgcgccaat
accgcgaaggacaacttcctcgcgctcgtatcgcacgaactgcgcgcgccgctgaacgtg
atctcgagctgggcggccgtgctcatgacggcaagcgagcgcggcatgccgaccgacgag
caaatgagtcagcgcgcggtcacgaccattctgcggcattgtcagctgcaggccgaactg
atcgacgatttgctggacgtctcgcgcatctcgtcgggacggttctcgctcgattcgaag
ccggtcgactttgctgcggccgtacgcaccgtggtggagagccatcgcccggtggcggcc
aagaaggagatcatgctcgcgacgtcgggattgcaaagccaggcggtcgtcagcggcgac
gcgcgccgtctgcagcaggtcgcatcgaatctgatcggcaatgcgttgaagttcacgccg
cagggcggccgtgtcgaagtcgcattgacgcgtctcggtgcgctgatcgagctctcggtc
gccgacaacggcatcggcgtcaagccggaattgctgccgcggctgttcgaccgtttcatg
cagtccgacaccagtcgcacgcgccagtatggcggcctcggcctgggcctgtcgatcgtc
aagcatctggtgacggcgcacggcggcacggtgaccgccagcagcgagggtgaaggtcgc
ggcaccaggctgacggttcgcataccgttgctgcagacggccgcgacggaaccgggaacc
gtcgccaccgcgccggcggaatcggcacggctcgacggcctgtcggtgctgctcgtcgac
gacgacgtgccggcccaggagccgttggcgcacttgctgcgcgggctcggcgcgcaagtg
cagatcgcttccggtgcgaaagaagcgctcgcctgtctcgctgccggctctttcgatatt
ctcgtcagcgatctcgccatgcccggcgccgacggccatgcgctgctgcgcgacgtgcgc
agtcgcgaaggcggccgacggcgcatctacgcgctggccctgacgggcctcgcgtcgata
cacgatcgggacgccgcgattgccgccggcttcgacgaccatttgccgaagccggtggat
gtgaaggtgctgctggaaaagctgtctctggggcggggcagatag

DBGET integrated database retrieval system