KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_4786Help
Entry
Bmul_4786         CDS       T00624                                 

Definition
ABC transporter
Orthology
K15558  
phthalate transport system ATP-binding protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
ABC transporters
Module
Phthalate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:bmu02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1907959..1908741
Genome map
AA seq 260 aa AA seqDB search
MSNIIINGLTKSFDTPTGPITVLDNIDLTVQEGEFVCLLGPSGAGKSVTLNCISGFLPPT
SGSVMVDGTPVTTARPRYGYVFQQPRLLQWRTVEENLIFALRAESGRPVKDEARRVRDVL
DLVNLTGYEHFYPHQISGGMQHRVGIARAYIRDSGLLLMDEPFGALDEITARKLRAELVS
TWMKNRRTVVFVTHDIIEACYLADRIVVYTPKPTRIASVINVDLPRPREYGSQQMHALES
EVLGVFEQSMKEFMETAGST
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatcatcattaacggtctcacgaagtcattcgatacgcccaccgggcccatc
accgttctggacaacatcgacctcacagtccaggaaggcgaattcgtttgcctccttggt
ccgtcgggcgcaggcaagtccgtcacgttgaactgtatttccggattcctcccccccact
tcggggagtgtcatggtggacggcacgccggttacaactgcaaggccgcgttatgggtat
gtgttccagcaaccaaggttgctccagtggcgcaccgtcgaagagaatcttatattcgcc
ctgcgcgccgaaagcggccgtccggtaaaggatgaagcacggagggttcgggacgtcctt
gatctggtgaacctgaccggttatgagcacttctacccgcatcagatctccggcggcatg
cagcatcgcgtcggtatcgcccgcgcctatatccgcgactccgggctcctgctcatggac
gaaccgtttggggcactcgacgaaatcaccgcccgcaaactgcgggctgaactggtcagc
acgtggatgaagaaccggcgcactgttgtcttcgtcactcacgacatcatcgaagcgtgc
tatctcgccgaccggatcgtcgtctacacgcccaagccgaccaggatcgcctccgtcatc
aatgttgatctgcctcggccgcgggaatacggaagccagcagatgcacgcgctcgaatca
gaggtactcggtgtgtttgagcaaagcatgaaggaattcatggagacggccggcagtacc
tga

DBGET integrated database retrieval system