KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5199Help
Entry
Bmul_5199         CDS       T00624                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bmul_5199
Enzymes [BR:bmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Bmul_5199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2349971..2350921
Genome map
AA seq 316 aa AA seqDB search
MHRELNQPMGGNEMPRFGGIATMMRLPQADTTDGLDACFVGVPLDLGTSNRSGSRFGPRQ
IRAESVLLRPYNMATRAAPFDSLQVADIGDVATNPYDLKDSVRRIEEAYDRIVANGCRPI
TLGGDHTIAWPILRALHRKYGKVAVVHVDAHADVNDTMFGEKIAHGTPFRRAVEDGLLQC
DKVTQIGLRGTGYHADDFDWCREQGFTVVQAEACWNQSLAPLMAQVRERVGDTPVYLSFD
IDGLDPSFAPGTGTPEIGGLSVQQGLEIVRGMKGLNIVGADLVEVSPPYDPAGTTALVGA
NLAFEMLCVMPGVAYR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcgaactgaaccaaccgatgggcggcaacgagatgccgcgctttggcggcatc
gccacgatgatgcgcctgccgcaggccgacacgaccgacggcctcgacgcatgcttcgtc
ggcgtgccgctcgacctcggcacgtcgaaccgctcggggtcgcgcttcggcccgcgccag
atccgcgccgaatcggtgctgctgcgcccctacaacatggccacgcgcgccgcgccgttc
gattcgctgcaagtggccgacatcggcgacgtcgcgacgaacccgtacgacctgaaggat
tcggtgcgccgcatcgaggaggcgtacgaccggatcgtcgcgaacggctgccgcccgatc
acgctcggcggcgatcacacgatcgcctggccgatcctgcgcgcgctgcaccggaaatac
ggcaaggtcgccgtcgtgcatgtcgatgcgcacgcggacgtcaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcggtcgaagacgggctgctgcaatgc
gacaaggtcacgcagatcgggctgcgcggcaccggctatcacgccgacgatttcgactgg
tgccgcgagcagggtttcaccgtcgtgcaggccgaggcatgctggaaccaatcgctggca
ccgctgatggcacaggtgcgcgagcgcgtcggcgacacgcccgtctatctgagcttcgac
atcgacggcctcgatccgtcgttcgcacccggcaccggcacgccggagatcggcgggctg
tccgtccagcagggcctcgaaatcgtgcgcgggatgaagggcttgaacatcgtcggcgcg
gatctcgtcgaagtgtcgccgccgtacgatccggccggcaccacggcgctcgtcggcgcg
aacctcgcgttcgagatgctgtgcgtgatgccaggcgtcgcgtaccgctga

DBGET integrated database retrieval system