KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5312Help
Entry
Bmul_5312         CDS       T00624                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bmu00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bmu00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2460854..2461639
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNLDGANAVADEINKAGGKAIGV
AMDVTNEEAVNTGIDKVAETFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTVDGVFTTVQDVAQTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctgaatggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggcaag
gaaatcgcgctggagctggcgaaggcgggtgcggccgtcgcgatcgccgatctgaacctg
gacggcgcgaacgcggtcgccgacgagatcaacaaggccggcggcaaggcgatcggcgtc
gcgatggacgtgaccaacgaggaagccgtcaacaccggcatcgacaaggtcgccgagacg
ttcggctcggtcgacattctcgtgtcgaatgccggcatccagatcgtcaacccgatcgag
aactactcgttcgccgactggaagaagatgcaggcgatccacgtcgacggcgcgttcctc
acgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggtgtcgtgatctac
atgggctcggtgcactcgcacgaggcgtcgccgctgaagtcggcctacgtgacggccaag
cacggcctgctcggtctcgcgcgcgtgcttgcgaaggaaggcgcgaaacacaacgtgcgc
tcgcatgtcgtgtgtccgggtttcgtgcgcacgccgctcgtcgacaagcagattccggag
caggccaaggagctcggcatcagcgaagaggaagtcgtgaagaaggtgatgctcggcaat
acggtcgacggcgtgttcacgaccgtgcaggacgtcgcgcagacggtgctgttcctgtcg
gcgttcccgagcgccgcgctgaccggtcagtcgttcgtcgtcagccacggctggttcatg
caatga

DBGET integrated database retrieval system