KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5345Help
Entry
Bmul_5345         CDS       T00624                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bmul_5345
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_5345
   00620 Pyruvate metabolism
    Bmul_5345
   00640 Propanoate metabolism
    Bmul_5345
  Energy metabolism
   00680 Methane metabolism
    Bmul_5345
Enzymes [BR:bmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bmul_5345
Lipid biosynthesis proteins [BR:bmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bmul_5345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:28706..30373
Genome map
AA seq 555 aa AA seqDB search
MPDGATARAVPAYADAVARFRIDTVAAQLHGDLEHGLNACVECCDRHASGDAVALDWIDI
DGAHHRFTFAQMKALAARVANLLVERGVKPGDVVAGLLPRTPELVATILGTWRAGAVYQP
LFTAFGPKAIEHRLRMSDARLVVTNVANRAKLDEVADCPPVATVRAAEAPLPDGDIDFRA
ALDAQSDTFEPVLRKGTDLFMMMSTSGTTGLPKGVPVPLRALLAFRQYMCDAVDLRAEDR
FWNIADPGWAYGLYYAITGPLLVGHATTLYEGGFTVDSTYDVIERLGITSLAGSPTAYRM
LMAAGSDAAARIKGKLRVVSSAGEPLNPEVVRWFDAALGAPIYDHYGQTELGMVVNNHHG
LAHVVHPGSAGFAMPGYRVAVLDDAGRELGPGEPGTLAIDIARSPLLWFDGYWRQDTPAI
AGGYYRTGDNVELEPDGTVSFIGRADDVITSSGYRIGPFDVESALIEHEAVSEAAVIGVP
DPERTEIVKAFVVLSNGYEGTPALAEALSLHVKRRLSAHAYPRAIEFVDALPKTPSGKIQ
RFVLRKMEADKAAQP
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatggagcaaccgcccgggcggtgccggcgtatgccgacgccgtggcccggttc
cgaatcgacactgtcgcggcgcagttgcacggcgacctcgagcatggcctgaacgcctgc
gtcgaatgctgcgatcgtcatgcgtccggcgatgcggtcgcactcgactggatcgacatc
gacggtgcgcatcatcgcttcacgtttgctcagatgaaagcgcttgcggcgcgcgtcgcg
aacctgctggtcgagcgcggcgtgaagccgggtgacgtggtggccgggctgttgccgcgc
acgcccgaactggtcgcgacgatcctcggtacgtggcgcgcgggcgccgtctatcagccg
ttgttcacggcgttcggtccgaaggcgatcgagcaccggctgcgcatgagtgatgcgcga
ctcgtcgtgacgaacgtcgcgaaccgcgcgaagctcgacgaggttgccgattgtccgccc
gtcgcgacggtgcgcgctgccgaagcgccgctgccggacggcgacatcgacttccgtgcg
gcgctggacgcgcagtccgatacgttcgagcccgtgctgcgcaagggcaccgacctgttc
atgatgatgtcgacgtcgggcacgacgggcttgccgaaaggcgtgcccgtgccgctgcgc
gcgctgctcgcgtttcgccagtacatgtgcgacgcggtcgacctgcgcgccgaagaccgg
ttctggaacattgccgatcccggctgggcatacggactgtattacgcgatcacggggccg
ctgctggtcggccatgcgacgacgctgtacgaaggcggctttacggtcgacagcacgtac
gacgtgatcgagcggctcggcattacgagcctcgccggttcgccgacggcgtaccggatg
ctgatggcggccggctccgacgcggccgcgcgcatcaagggcaagctgcgcgtagtcagc
agcgcgggcgaaccgctgaacccggaagtcgtgcgctggttcgatgcggcgctcggcgcg
ccgatctacgatcattatggccagaccgagcttggcatggtcgtgaacaaccatcacggg
ctcgcgcacgtcgtccatcccggttccgcgggtttcgcgatgccgggctaccgcgtcgcg
gtgctcgacgacgcaggtcgcgagctcggcccgggcgagcccggcacgctcgcgatcgac
atcgcgcgttcgccgctgctgtggttcgacggatactggcggcaggacacgccggcgatc
gcaggcggctattaccgcacgggcgacaacgtcgagctcgagccggacggaaccgtcagc
ttcatcggccgcgcggacgacgtcatcacgtcgtccggctaccggatcggcccgttcgac
gtcgagagcgcgctgatcgaacatgaggcggtcagcgaggcggccgtgatcggcgtgccc
gaccccgagcgcacggagatcgtcaaggccttcgtcgtgctgtcgaacggctacgaaggc
acgccggcgctcgccgaagcgttgagtctgcacgtgaagcggcggctgtccgcgcacgcc
tatccgcgcgcgatcgagtttgtcgacgcgctgccgaaaacgccgagcggcaagatccag
cgcttcgtgctgcgcaagatggaggccgacaaggccgctcaaccctga

DBGET integrated database retrieval system