KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5834Help
Entry
Bmul_5834         CDS       T00624                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:552973..553704
Genome map
AA seq 243 aa AA seqDB search
MGNLIDAPARTLTAIDEGIPLSLIIRRRLEHAGARFHANDNIAAHLRDGELDALQNEVAQ
QMEAVLRSLVIDVDNDHNTRETAQRVAKMFIREVFAGRYEAAPLVTEFPNVERLDELLIV
GPLRVRSACSHHLCPIMGRIWIGVLPSATSNLIGLSKYGRLVNWVMTRPQIQEEAVKQIA
DLLESRIAPDGLAVVLEADHFCMHWRGTKDDQAKMTNSVMRGKFLADASLRREFLALLPG
KNA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatctgatcgacgctcccgcgcgtacgctgactgcgatcgacgagggcattcct
ctgtcgctcatcattcgccggcggctcgagcacgcgggcgcacgcttccatgccaacgac
aacatcgccgcgcacctgcgtgacggcgaactggatgcattgcagaacgaagtcgcacag
caaatggaagcggtgctgcgctcgctggtgatcgacgtcgacaacgaccacaacacccga
gagaccgcacagcgcgtcgcaaagatgttcatccgcgaagtgttcgcgggccgctacgag
gcagcgccgctcgtgaccgaattcccgaacgtcgagcggctcgacgagttgctgatcgtg
ggcccgctgcgcgtacgcagcgcgtgctcgcatcacctttgcccgatcatgggccgcatc
tggatcggcgtgctgcccagcgccacgtcgaacctgatcggcctgtcgaagtatggacgg
ctggtgaactgggtcatgacgcgcccgcagatccaggaggaagcggtcaagcagattgcc
gacctgctcgaatcgcgcatcgcgcccgacgggctggcggtcgtgctcgaggccgaccac
ttctgcatgcactggcgcggcaccaaggacgatcaggcaaagatgaccaacagcgtgatg
cgcggaaagtttctcgcggacgcatcgctgcgccgggagtttctcgcgttgttgccggga
aagaatgcataa

DBGET integrated database retrieval system