KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5875Help
Entry
Bmul_5875         CDS       T00624                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00010  Glycolysis / Gluconeogenesis
bmu00030  Pentose phosphate pathway
bmu00051  Fructose and mannose metabolism
bmu00052  Galactose metabolism
bmu00680  Methane metabolism
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01200  Carbon metabolism
bmu01230  Biosynthesis of amino acids
Module
bmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_5875
   00030 Pentose phosphate pathway
    Bmul_5875
   00051 Fructose and mannose metabolism
    Bmul_5875
   00052 Galactose metabolism
    Bmul_5875
  Energy metabolism
   00680 Methane metabolism
    Bmul_5875
Enzymes [BR:bmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bmul_5875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin FtsQ
Motif
Other DBs
NCBI-ProteinID: ABX19535
Position
3:complement(594125..595105)
Genome map
AA seq 326 aa AA seqDB search
MPRIAAPAIDCEPRIMTDIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVA
RTIHRLGGDCVALYLAGGPTGDVLTLLLEAERLPAVRIRIAGETRENVCVTETATGREYR
FLMPGPLVTEAEWRDCAARIDTLHPAPRYLVLSGSLPPGAPDDLYATLARTARARGSRVV
VDAAGRALQAALEAGVHLVKPSLGELSALAGEPLDETSACRKASELVARGQADIVALTLG
ARGAWVVTRDGALRLPGRPATVCSTVGAGDSFVGGMVWALARGVPFDEACRYALAASAAS
VEHPGTALCTRDDVERIHAELVAQAS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgaatcgccgcgccagccatcgactgcgaaccgcgcatcatgaccgatatcgtt
accgttaccctgaatccggccgtcgatgtcgcgacgtccgtcgagcacatcgtcgatacg
cacaagctgcgctgtgcacggccgcggcgcgaccccggcggcggcgggatcaacgttgcc
cgaaccattcaccgcctcgggggcgactgcgtcgcgctgtacctggccggcgggccgacc
ggcgacgtcctgacgctgctgctcgaagccgagcgtctgccggcggtgcgcatccggatc
gccggcgagacgcgcgagaacgtctgcgtgaccgagaccgcgaccgggcgcgagtaccgc
ttcctgatgcccgggccgttggtcaccgaggccgagtggcgcgactgcgcagcccgcatc
gacaccctgcacccggcgccgcgctatctcgtgttgagcggcagcctgccgcccggcgcg
cccgacgatctgtatgcgacgctggcgcggacggccagggcgaggggcagccgggtggtc
gtcgacgcggcggggcgggcactgcaagctgctctcgaggccggcgttcatctcgtgaag
cccagtctcggcgaactgagcgcgttggccggcgagccgctcgacgagacgtcggcatgc
cggaaggccagcgaactcgtggcgcgaggacaagccgacatcgtcgcgttgacgctcggt
gcgcgcggcgcatgggtcgtcacgcgcgacggcgcgctgcgcctgcccggcaggccggca
acggtatgcagcacggtcggggccggcgacagtttcgtcggcggcatggtctgggcgctg
gcgcgcggcgtgccgttcgacgaagcgtgccgctatgcgctggcggcttcggccgcttcg
gtcgagcatccggggacggcgctgtgcacgcgcgacgacgtcgagcggattcacgctgaa
ctggttgcgcaagcaagctga

DBGET integrated database retrieval system