KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5891Help
Entry
Bmul_5891         CDS       T00624                                 

Definition
beta-lactamase domain-containing protein
Orthology
K07576  
metallo-beta-lactamase family protein
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:612926..614329
Genome map
AA seq 467 aa AA seqDB search
MKLTFLGATETVTGSKYLVEHGGRRVLVDCGLFQGTKNLRLRNWRTLPLAPDTLDAVVLT
HAHIDHTGYLPVLVREGYRGPVYCTAATAELCDIMLRDSARLQEEEADFANRHGYSKHHP
AQPLYTLDDAQRALRLLTPVAFDECTALGGAVSFRLLPAGHILGAASVVMHWDQKVLAFS
GDLGRYHDPIMQPPRPPAHADYLVIESTYGDRLHPASDPENELAEMFDKTFARGGVVVMP
CFTVGRAQEILHYIARLKASGRMARVPVFVDSPMATDVTEIYRHHILEHRLTVSEANALG
HAATMIRSVDQSKAIAEHHGPMVIIAGSGMATGGRVLHHLARYAPDARNTIALVGYQAAG
TRGAALAAHEPTLKIHGEYVRVRAQVESITTLSAHADYEEILKWLGTMPCAPVRTFVTHG
EPAAADAMRRRIEERLHWRCEVPTYEQCVDLDAVESGNTQEPAALPT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacttttctcggcgcgaccgaaaccgtgaccggctcgaagtatctggtcgag
cacggcggtcgacgtgttctggtcgattgcggcctgttccagggcacgaagaacctgcgg
ctgcgcaactggcggacgctgccgctcgcccccgacacgctggacgccgtcgtgctcacg
cacgcgcacatcgatcacaccgggtatctcccggtactggtgcgcgaagggtatcgcggg
ccggtgtactgcacagcagccacggccgaactctgcgacatcatgctacgcgacagcgcg
cggctgcaggaggaggaagccgacttcgctaaccggcacggttactcgaagcatcatccg
gcgcaaccgctctacacgctggacgacgcgcagcgcgcgctgcgcctgctgacgcccgtc
gcgttcgacgaatgcacggcgctgggcggcgccgtgtcgttccgcctgctgccggccggg
cacatcctcggcgcggcgagcgtggtgatgcactgggatcagaaggtgctcgcgttctcg
ggcgacctcggccggtatcacgacccgatcatgcagccgccgcgcccgcccgcgcatgcc
gactatttggtcatcgaatcgacatacggcgaccgcctgcatccggcgtcggatcccgag
aacgaactggccgagatgttcgacaagaccttcgcgcgtggcggcgtcgtcgtgatgccc
tgcttcaccgtcggccgcgcgcaggaaatcctgcactacatcgcgcggctgaaggcatcc
ggccgcatggcgcgcgtcccggtgttcgtcgacagcccgatggcgacggacgtgaccgaa
atctaccgccaccatatcctcgagcaccgcctgaccgtctccgaagcgaacgcgctgggc
catgcggcaacgatgatccggtcggtcgaccagtcgaaggcgattgccgaacaccacggc
ccgatggtcatcattgccggcagcgggatggcgacgggcggacgcgtgctgcatcacctg
gcccgctacgcgccggatgcgcgcaacacgatcgcgctggtcggctaccaggccgccggc
acgcgcggcgcggcactggccgcgcacgagccgacgctgaagattcacggcgaatacgtt
cgcgtgcgcgcgcaggtcgagtcgatcacgacgctgtcggcccatgccgactacgaagag
atcctgaagtggctcggcacgatgccgtgcgcgcccgtgcggacgttcgtcacgcatggc
gaacccgccgccgcggatgcgatgcgccgacgcatcgaggagcgcctgcactggcggtgc
gaggtgccgacctacgagcagtgcgtcgatctggacgcggttgaatccggcaacacgcag
gagcctgccgcgctgcctacgtga

DBGET integrated database retrieval system