KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5905Help
Entry
Bmul_5905         CDS       T00624                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
bmu00010  Glycolysis / Gluconeogenesis
bmu00071  Fatty acid degradation
bmu00350  Tyrosine metabolism
bmu00625  Chloroalkane and chloroalkene degradation
bmu00626  Naphthalene degradation
bmu01100  Metabolic pathways
bmu01110  Biosynthesis of secondary metabolites
bmu01120  Microbial metabolism in diverse environments
bmu01130  Biosynthesis of antibiotics
bmu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmul_5905
  Lipid metabolism
   00071 Fatty acid degradation
    Bmul_5905
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bmul_5905
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bmul_5905
   00626 Naphthalene degradation
    Bmul_5905
Enzymes [BR:bmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bmul_5905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N GFO_IDH_MocA 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABX19565
UniProt: A0A0H3KUW5
Position
3:complement(627800..628789)
Genome map
AA seq 329 aa AA seqDB search
MLAMMFDGTTPHLRETRVPDPSPTAGQLLIDVNACGVCRTDLHVVDGELAHAKLPLIPGH
EIVGTVRGLGEGVTGFAVGDRVGVPWLGSTCGHCAYCTSGRENLCDSPGFTGYTIDGGYA
ECAVADHRYCVHLPRRYSDLEAAPLLCAGLIGYRTLRMAGNARRIGIYGFGAAAHLVAQV
AQGEGRKVFALTKPGDTAAQRLALSLGAAWAGGSDEVPPEPLDAALIFAPSGALVPAALR
VLDKGGIVVCGGIHMSDIPGFPYAWLWGERRIASVANLTRADAVAFMRIAAATPLRVAAV
RYALTEANRALDDLRGGRVSGAAVLDMHD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcgatgatgtttgacggcacgacgccgcacttgcgcgaaacgcgcgtgccggac
ccgtcgcctacggctggtcagttgctgatcgacgtgaatgcgtgtggcgtatgcagaacc
gatctccacgtggtcgacggcgaactcgctcacgcgaaactgccgttgattccggggcac
gagatcgtcggcacggtgcgcgggctgggcgaaggcgtgacgggcttcgccgtcggagac
cgggtgggtgtcccgtggctgggctcgacatgcgggcattgcgcgtattgcacatccggt
cgcgagaacctgtgcgacagcccgggtttcacgggctatacgatcgacggcggttatgca
gagtgcgcggtcgccgaccaccggtattgcgtgcatctgccgcggcgctattccgatctg
gaggccgcgccgctgctgtgcgccggcctgatcggttatcgaaccttgcgcatggcgggc
aatgcgcgccgtatcggcatctacggcttcggtgcggcggcgcatctggtcgcacaggtc
gcgcagggtgaaggacgcaaggtgttcgcactgacgaagcccggcgacaccgcggcgcag
cgactggcgttgtcgctgggcgcggcatgggccggcggcagcgacgaagtgccgccggag
ccgctcgatgccgcactgatttttgcgccgtctggtgcgctggtgccggccgcgctgcgg
gtactcgacaaaggcgggatcgtcgtgtgcggcggcattcacatgagcgacatcccgggc
tttccgtacgcgtggctgtggggcgagcgccgcatcgcgtcggtggccaatctgacgcgt
gcggatgcggttgcattcatgcggatcgccgccgcgacgccgctgcgggtcgcggcagtg
cgctacgcgctgaccgaggcgaaccgtgcactcgacgacctgcgcggcggacgcgtgtca
ggcgccgccgtgctcgacatgcacgattga

DBGET integrated database retrieval system