KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_5976Help
Entry
Bmul_5976         CDS       T00624                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bmu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bmu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:708851..710893
Genome map
AA seq 680 aa AA seqDB search
MHVAFRSPLHDTLRFSTENTLTALVSILHERRIFEPTADTRDRATLSGMEAYRALAAEAE
RDYEGFWARLAREGLAWHKPFTKVLDESDAPFYKWFDDGELNASYNCLDRHVEAGNGERV
AVIFEADDGTVTRVTYADLLARVSRFANALKKRGIGKGDRVVIYMPMSIEGIVAMQACAR
IGATHSVVFGGFSAKSLNERLVDVGAVALITADEQVRGGKTLPLKNIADEAIAMGGCDAV
KSVIVYRRTGGKIDWHADRDLWMHELADGESDTCAPEWVGAEHPLFILYTSGSTGKPKGV
QHSTGGYLLWAAQTVKWTFDWKPTDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVP
TYPDAGRFWKMIGDHKVSVFYTAPTAIRSLIKAAEADEKVHPKSYDLSSLRIIGTVGEPI
NPEAWMWYHKHVGQERCPIVDTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVD
ETGQDVPNGQGGILVVKRPWPSMIRTIWGDPERFKKSYYPEELGGRLYLAGDGTVRDKDT
GYFTIMGRIDDVLNVSGHRLGTMEIESALVAHELVAEAAVVGRPDDTTGEAVVAFVVLKR
ARPEGEEAAALAKALRDWVGKQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAI
TQDTSTLENPAILRQLARAL
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttgcgtttcgttcgccattgcatgacacgttgcgcttttccacggagaacacc
ttgaccgccctcgtctcgatccttcacgaacgtcgaatcttcgaaccgacggccgacacg
cgcgaccgcgcgaccctttccggcatggaggcctatcgcgcactggccgccgaggccgag
cgcgattacgaagggttctgggcgcgcctcgcgcgcgagggcctcgcgtggcacaagccg
tttacgaaggtgctcgacgagtccgatgcgccgttctacaagtggttcgacgacggcgaa
ctgaatgcgtcgtacaactgtctcgaccgccacgtcgaagccggcaacggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctatgccgacctgctc
gcgcgcgtctcgcgcttcgccaatgcgctgaagaaacgcggcatcggcaagggcgaccgc
gtcgtcatctacatgccgatgtcgatcgaaggcatcgtcgcgatgcaggcctgcgcgcga
atcggcgcgacgcactcggtcgtgttcggcggcttctccgcgaaatcgctgaacgagcgg
ctcgtcgatgtcggcgccgtcgcgctgatcacggccgacgaacaggtgcgcggcggcaag
acgctgccgctgaagaacatcgccgacgaagcaatcgcgatgggcggctgcgacgcggtg
aagagcgtgatcgtctatcgccgcaccggcggcaagatcgactggcatgccgatcgcgac
ctgtggatgcacgaactggccgacggcgaatccgacacctgcgcgcccgaatgggtcggc
gccgagcatccgctgttcatcctctacacgtccggttcgaccggcaagccgaagggcgtg
cagcacagcacgggcggctacctgctgtgggccgcgcagacggtgaagtggaccttcgac
tggaagcccaccgacgtgttctggtgcacggccgacatcggctgggtcacgggccacacc
tacatcacgtacggcccgctcgcatgcggcggcacgcaggtcgtgttcgaaggcgtgccg
acgtatcccgatgcgggccgcttctggaagatgatcggcgatcacaaggtcagcgtgttc
tatacggcgccgaccgcgatccgctcgctgatcaaggccgccgaagccgacgagaaagtg
catccgaagagctatgacctgtcgagcctgcgcatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatgtggtaccacaagcacgtcggccaggagcgctgcccgatcgtc
gacacgtggtggcagaccgaaaccggcggccacatgatcacgccgctgccgggcgcgacg
ccgaccgtgcccggttcatgcacgctgccgctgccgggcatcatggccgcggtcgtcgac
gagacgggccaggacgtgccgaacggtcagggcggcattctcgtcgtcaagcggccgtgg
ccgtcgatgatccgcacgatctggggcgacccggagcgcttcaagaagagttactacccc
gaggaactcggcgggcgcctgtatctggccggcgacggcaccgtgcgcgacaaggacacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtgtccggtcaccggctc
ggcacgatggagatcgagtcggcgctcgttgcgcacgagctcgtggccgaagccgcggtg
gtcggccgtcccgacgacacgacgggcgaagcggtggtcgcgttcgtcgtgctcaagcgc
gcgcggcccgaaggcgaagaggccgcggcgctcgcgaaggcgctgcgcgactgggtcggc
aagcagatcggcccgatcgcgaagccgaaggacatccgcttcggcgacaacctgccgaag
acgcgctcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggccatc
acgcaggacacgtccacgctcgagaatccggcgattctcaggcagctcgcccgcgcactg
tag

DBGET integrated database retrieval system