KEGG   Burkholderia multivorans ATCC BAA-247: NP80_575Help
Entry
NP80_575          CDS       T03881                                 

Gene name
pcaF
Definition
(GenBank) 3-oxoadipyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmul  Burkholderia multivorans ATCC BAA-247
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bmul00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NP80_575 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    NP80_575 (pcaF)
   00640 Propanoate metabolism
    NP80_575 (pcaF)
   00650 Butanoate metabolism
    NP80_575 (pcaF)
  Lipid metabolism
   00071 Fatty acid degradation
    NP80_575 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    NP80_575 (pcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NP80_575 (pcaF)
   00310 Lysine degradation
    NP80_575 (pcaF)
   00380 Tryptophan metabolism
    NP80_575 (pcaF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NP80_575 (pcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NP80_575 (pcaF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NP80_575 (pcaF)
Enzymes [BR:bmul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NP80_575 (pcaF)
Exosome [BR:bmul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NP80_575 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1:complement(604845..606047)
Genome map
AA seq 400 aa AA seqDB search
MTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALIERNRDVDWNAVDDVIYGCANQA
GEDNRNVARMSALLAGLPTAVPGATLNRLCGSGMDAIGTAARAIKAGEARLMIAGGVESM
TRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQQYGVDSMPETAENVAVDYNVSRAD
QDLFALRSQQKAARAQQDGTLAEEIVPVTIAQKKGDPLVVSRDEHPRETSLEALAKLKGV
VRPDGTVTAGNASGVNDGACALLLANAEAADQYGLRRRARVIGMATAGVAPRVMGIGPAP
ATQKLLQQLGMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGA
SGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIALAIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcctatatctgcgatgccattcgcacccctatcggccgctacggcggcgcc
ctgaaagacgtccgcgcggacgacctcggcgcggtgccgctgaaggcgctgatcgagcgc
aaccgcgacgtcgactggaacgcggtcgacgacgtgatttacggctgcgcgaaccaagcc
ggcgaagacaaccgcaacgtcgcgcgcatgtcggcgctgctggccgggctgccgaccgcc
gtccccggtgcgacgctgaaccggctctgcggctcgggcatggacgcgatcggcacggcc
gcgcgcgcgatcaaggccggcgaagcgcggctgatgatcgccggcggagtcgaaagcatg
acgcgcgcgccgttcgtgatgggcaaggccgcgagcgcattcgcgcgtcaggccgacatc
tacgacacgacgatcggctggcgtttcgtcaatccgctgatgaaacagcaatacggcgtc
gactcgatgccggagacggccgagaacgtcgcggtcgactacaacgtgagccgcgccgat
caggatctgttcgcgctgcgcagccagcagaaggcggcccgcgcgcagcaggacggcaca
ctggccgaggaaatcgtgcccgtcacgattgcgcagaagaagggcgacccgctcgtcgtg
tcgcgcgacgagcatccgcgcgaaacgtcgctcgaagcgctcgcgaagctgaagggcgtc
gtgcgcccggacggtacggtgacggccggaaacgcgtcgggcgtcaacgacggcgcgtgc
gcgctgctgctcgcgaatgccgaagcggccgaccagtacggcctgcgccgccgcgcgcgc
gtcatcggcatggcgaccgccggcgtcgcgccgcgcgtgatgggcatcggcccggcgccg
gccacgcagaagctgctgcagcaactcggcatgacgatcgatcagttcgacgtgatcgag
ctgaacgaagcgttcgcgtcgcagggcctcgcggtgctgcgcatgctcggcgtcgccgac
gacgatccgcgcgtgaacccgaacggcggcgcgatcgcactcggccatccgctcggcgcg
tcgggcgcgcggctcgtgacgacggcgatgtatcagctgcatcgcacgaacggccgcttc
gcgctctgcacgatgtgcatcggcgtcgggcaaggcatcgcgctcgcgatcgaacgcgta
tag

DBGET integrated database retrieval system