KEGG   Burkholderia mallei SAVP1: BMASAVP1_0626Help
Entry
BMASAVP1_0626     CDS       T00457                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:638752..639147
Genome map
AA seq 131 aa AA seqDB search
MGFDDRKEDMVIIRSIAVHGVCPHHLLPFRGVAHVAYLPGGRLHGFGRIARMIDAISHRF
TYQEWITNEIATALVTHGKARGAACLIEAEQLCLLMGENRRGDERVITQCYVGEFDHNAQ
ARNEFLRAINR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttcgatgatcgaaaggaagatatggtcatcatccgcagtatcgctgtccatggt
gtttgtccgcatcacttgttgccatttcgcggcgtggcacacgtggcctatctgccggga
gggcgactgcatggcttcgggcgcatcgcccgtatgatcgatgcgatcagccatcgattt
acataccaagagtggattacaaacgagattgcgacagcccttgtcactcatggaaaagca
cggggagcagcttgcctgatcgaagccgaacaactgtgcttgctcatgggcgaaaatcgc
cgcggcgacgagcgcgtaattacgcaatgctacgtgggcgaatttgaccataacgcccag
gcgcgcaacgagtttcttcgcgccatcaatcgatag

DBGET integrated database retrieval system