KEGG   Burkholderia mallei SAVP1: BMASAVP1_0652Help
Entry
BMASAVP1_0652     CDS       T00457                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bmv  Burkholderia mallei SAVP1
Brite
Enzymes [BR:bmv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BMASAVP1_0652
Secretion system [BR:bmv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BMASAVP1_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(662091..662819)
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEV
NLGSQIVYSDASGDYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGA
RKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTVKSKSIWCASDRVKSWQS
WMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAG
VK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgattcgtatcgccgcgctcgccctggctgccgcgacggcgacgctcggc
tgcaccgcgcaggccgaccagtccaccgacaagctgaaggccgcgctgcaatcgcgcctc
ggcgccgacgcgccgatcaagagcgtgacgaagtcgccgattgcgggtttgtacgaggtc
aatctcggctcgcagatcgtctatagcgacgcatcgggcgattacgtgctgctcggcgag
ctcgtcaacacgaagacgcacaagaacctcacggccgagcgcctcgccgagatcaacaag
atcgatttcgcgagcctgccgctgtcgaacgcgatcaaggtcgtgaagggcaacggcgcg
cgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctcgagacgacg
ctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctgtcgcccgat
tcgacggtgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaagagctggcagtcg
tggatgctcgagcatcgcgcgcccacgagcgcggcgaactgcgacacgaccgcgctcgac
aagaacctcgcgctcggccgcggaatgaacgtgacgggcacgccgaccgtattcctcgcc
gacggcacgcgcctgccgggcgccgtatccgccgacgaactgaatcaggcgctcgccggc
gtcaagtga

DBGET integrated database retrieval system