KEGG   Burkholderia mallei SAVP1: BMASAVP1_0976Help
Entry
BMASAVP1_0976     CDS       T00457                                 

Definition
dihydroflavonol-4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bmv  Burkholderia mallei SAVP1
Brite
Enzymes [BR:bmv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BMASAVP1_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:988546..989562
Genome map
AA seq 338 aa AA seqDB search
MRTMTDIQRDLVLVTGASGFVGSAVARAARRQGYRVRVLVRLTSPRTNVADLDAEIATGD
MRDEASMRAALRGVRHLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYT
SSVATLKVTPSGASADESSPLAAGQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTP
IGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAQGHLLALERGRVGERYILGG
ENLPLQAMLADIAQSTGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLRMSKN
KMYFTSAKAERELGYRARPYREGIRDALDWFRQAGYLR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccatgactgacatacaacgcgatctcgttctggtgaccggcgcatccggtttt
gtcggctccgccgtcgcgcgcgccgcgcggcggcagggctatcgggtgcgcgtgctcgtg
cggctgacgagcccgcgcacgaacgtcgcggatctcgacgccgagatcgccaccggcgac
atgcgcgacgaggcatcgatgcgcgccgcgctgcgcggcgtgcgccatctgctgcacgtc
gccgccgactaccggctgtgggcgcccgatccgctcgagatcgagcgcgcgaatctcgaa
ggcgcggtcgcgacgatgcgcgcggcgctcgccgagggcgtcgagcggatcgtctacacg
agcagcgtcgccacgctgaaggtgacgccgtcgggcgcctcggccgacgaatcgtcgccg
ctcgccgccgggcaggcgatcggcgtatacaagcgcagcaaggtgctcgccgagcgcgcg
gtcgagcggatgatcgccgaggacgggctgcccgcggtgatcgtcaatccgtcgacgccg
atcggcccgcgcgacgtgaagccgacgccgaccggccggatcatcgtcgaggcggcgctc
ggcaagatcccggcgttcgtcgacacggggctgaacctcgtgcacgtcgacgacgtcgcg
cagggccacctgctcgcgctcgagcgcgggcgcgtcggcgagcgctacatcctcggcggc
gagaacctgccgctgcaggcgatgctcgccgacatcgcgcaatcgacgggacgcaagccg
ccgacgatcgcgctgccgcgctggccgctgtatccgatcgcgctcggcgcggaggcggtg
gcgaagctgacgaagcgcgagccgttcgtgacggtcgacgggctcaggatgtcgaagaac
aagatgtatttcacgtccgcgaaagccgagcgcgagctcggctaccgcgcgcggccgtac
cgcgaaggcattcgcgacgcgctcgactggttcaggcaggcgggctatctgcgctga

DBGET integrated database retrieval system