KEGG   Burkholderia mallei SAVP1: BMASAVP1_1045Help
Entry
BMASAVP1_1045     CDS       T00457                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bmv  Burkholderia mallei SAVP1
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BMASAVP1_1045
Enzymes [BR:bmv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BMASAVP1_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1050423..1052384
Genome map
AA seq 653 aa AA seqDB search
MNGRAKGRRFNAITHAPCFELMLGATRSTLWGSRERPRIAAARAPGAAAIRMREEARECA
GPRGAGRAPHRATAAGGKTGRRTVRAPSRARAGSNNQKVNRMKQQSYDYDYVVVGSGFGG
SVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWRPALGLHGFFSMRFFRHVVV
LHGNAVGGGSITYANTLLVPPNKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMD
AADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGC
MVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGA
RGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKS
RVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAK
LVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPA
YIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFG
YRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQRWDSTAETPVAA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
ttgaatggccgcgcaaaagggcggcgattcaatgcgataacgcacgcaccgtgtttcgaa
ttgatgctcggcgcaacgcgctcgacactatggggttctcgtgagcggccgcggatcgcg
gcggcgcgcgcgccgggcgccgccgcgatccggatgcgcgaagaggcgcgggaatgcgcg
ggaccacgcggcgcaggccgtgcgccgcatcgcgcaacggcggccggcgggaaaacaggg
agacgaaccgttcgtgcaccgtcgcgcgcgcgggccggttcgaacaatcaaaaggtgaac
cgaatgaagcagcagtcctacgattacgactacgtcgtggtcggctccggcttcggcggc
agcgtctcggcgctgcgtctgtccgagaaaggctatcgtgtgctcgtgatcgagcagggc
cgtcgctggacgcccgagaacctgccggaaagcacgtggaacctgtcgcgctggcaatgg
cgccccgcgctcgggctgcacggcttcttcagcatgcgctttttcaggcacgtcgtcgtg
ctgcacggcaatgcggtgggcggcggctcgatcacgtacgcgaacacgctgctcgtgccg
cccaacaaggtctggcgcgagggcacatgggccggcctcgaggactgggaacgcgtgatg
cccgcgcactacgccaccgcgaagcgcatgctcggcgtcgtcacgaaccggcgaatggat
gcggccgacttccggctgaaggacatggcgaagctgatcggcgtcgagaagagcttctat
ccgaccgaggtcggcgtgttcttcggcgacgacgccgacgcgcccggcacgcgctacgcc
gatccgtacttcggcggcgcgggcccggagcgcacgtcgtgcatcggctgcggcggctgc
atggtcggctgccgccacggcgcgaagaacacgctcgaccgcaattacctgtatctcgcc
gagcgcctcggcgcgcaggtgcgcgagcagacgaaggtcgtcgacgtgcgcccgctcgac
gcgcgcgccgacggcgcggcgggctacgcggtcgaagcggtgtcgctcgcggcgggcgcg
cgcggcgcgaaaagccgcctcacgtgccgcggcgtcgtgttcgccgcatcctcgctcggc
acgcaggatctgctgatgcgcctgaaggaaaagggctcgctgccccggctatcggacgcg
ctcggcaagcgcgtgcgcacgaacgccgaatcgctgatcggcgtgcgctttccgaaatcg
cgcgtcgatctgtcgaagggcgtggcgatcggctcgggcatctacatcgacgagcacacg
cacatcgaggccacccgctatccttcgggctccgacacgatggggctgctcacgaccgtg
ctcacgcgcggcgcgccgggcggtttgcgtgtgctcgtgtggctcggcgcgctcgcgaag
ctcgttctcacgcgaccgctgagcgcgtggcggatgatcgacccgcgcggcttcgcgcgc
gagacgatgatcttcctctgcatgcagacgctcgaaggacacctgacgatgcgcctgaag
cgccgctggttctggccgttctcgaagcagctcgcgacctccggcgcgaagatccccgcc
tacattccggccgcgaacgacttcgcgcagaaggccgcgcgcgcgctcggcggcgtgccg
atgacctcgctcaccgagatcctgctgaacgtgccgatgaccgcgcattgcatgggcggc
gcggcgatggcgcgcgacgcgcgcgacggcgtgtgcgacggccgcagccgcgtgttcggc
tatcggaacatgtacgtctgcgacggctcggtgctcggcgcgaacctcggcgtcaacccg
agcctcacgatcacggcgctcgccgagcatgcgatgagccacgtgcccgccgcgcgcgag
cagcggtgggacagtaccgcggagacgcctgtcgcggcatga

DBGET integrated database retrieval system