KEGG   Burkholderia mallei SAVP1: BMASAVP1_1197Help
Entry
BMASAVP1_1197     CDS       T00457                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(1204626..1205504)
Genome map
AA seq 292 aa AA seqDB search
MAEVTANGGRARRMGQRAAAVRKASHGARSRRKHETMIGRPQPSRPSWSSMHMAKGMTAG
KATAPAARQAARRTSNKASKTASSAATHEPAGAPANRPSRDEAEAAVRVLLRWAGDDPQR
EGLVDTPARVVRAYEEFFAGYALEPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVP
IIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQIQEKMTVQIADTLFDVLQPKGVGVILE
AAHQCISTRGIHKPGVEMVTSRMLGTFRTDPATRREFLSIVANPSSVNLTNT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtgacggcgaacggcggccgcgcacgacgcatggggcaacgcgcggccgcc
gttcgcaaagcgagtcacggcgcacgctcgcgacgaaagcatgaaacaatgatcggccgg
ccgcagccttcgcggccttcatggagttcaatgcatatggctaaaggaatgaccgcgggc
aaggcgacggcaccggccgcgcgccaggcggcgcgcaggacatcgaacaaagcgagcaag
acggcgagctcggcggccacgcacgagccggccggcgcgcccgcgaaccggccgagccgc
gacgaagccgaagcggccgttcgcgtgctgctgcggtgggccggcgacgatccgcaacgc
gaggggctcgtcgatacgccggcgcgcgtcgtgcgcgcctacgaggagttcttcgccggc
tacgcgctcgaaccgcgcgacatcctcgcgcgcacgttcagcgaggtcgacggctacgac
gaaatgatcgtgctgaaggacatccgcttcgaaagctattgcgagcaccatatggtgccg
atcatcggccgcgcgcacgtcgcatatctgccgaaccatcgcgtcgtgggcatctcgaag
ctcgcgcgcctcgtcgatgcgttcgcgaagcgcctgcagatccaggaaaagatgacggtg
cagatcgccgatacgctgttcgacgtgctgcagccgaagggcgtcggcgtgattctcgaa
gcggcgcaccagtgcatctcgacgcgcggcatccacaagcccggcgtcgagatggtgacg
tcgcggatgctcggcacgttccgcaccgatccggccacgcgccgcgaattcctgtcgatc
gtcgcgaatccttcctcggtcaacctgacgaacacctaa

DBGET integrated database retrieval system