KEGG   Burkholderia mallei SAVP1: BMASAVP1_1276Help
Entry
BMASAVP1_1276     CDS       T00457                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMASAVP1_1276 (deoA)
Enzymes [BR:bmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BMASAVP1_1276 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:1274577..1275908
Genome map
AA seq 443 aa AA seqDB search
MQTMTFLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSAR
IALTLAQRDSGDVLDWRGARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRG
LGHTGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQTAQLAPADKRIYAVRDVTAT
VESISLITASILSKKLAAGVGALAMDVKVGSGAFMPSAEQSAELARSIVDVGNGAGMRTA
ATLTDMNQALAPCAGNAIEVRCAIDFLTGAARPARLEAVSFALAAQMLTMGGLAADAHDA
RRRLRAVLESGAAAERFARMVAALGGPADLVERPERHLPRAAAAAPVAAARAGWIERIDA
RALGLAVVGLGGGRAKIGDTLDYSVGLSALAELGERVEAGQPLATVHARDADSAAQATDA
VRRAYRIGAEPPAQTRVVHAVIE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccatgaccttcctgccgcaggaattcatccgcaaggtgcgcgaccgcgcgccg
ctcgacacggccgacgtcgcgcgtttcgtccaaggcgtgacggcgggcgacgtgaccgaa
ggccagatcgccgcgttcgcgatggcggtctatttcaacgagttgccgctgtccgcgcgc
atcgcgctgacgctcgcgcagcgcgattccggcgacgtgctcgactggcgcggcgcgcgc
ctgaacgggccggtggtcgacaagcactcgacgggcggcgtcggcgatctgacctcgctc
gtgatcgggccgatggtggccgcgtgcggcggctacgtgccgatgatctcgggccgcggc
ctcggccacacgggcggcacgctcgacaagctcgaggcgattcccggttacgatgtcgcg
ccgtccgtcgacatgctgcgccgcgtcgtgcgcgacgcgggccttgcgatcgtcggccag
accgcgcagctcgcgcccgccgacaagcggatctatgcggtgcgcgacgtgacggcgacc
gtcgaatcgatctcgctgatcaccgcgtcgatcctgtcgaagaagctcgcggcgggcgtc
ggcgcgctcgcgatggacgtgaaggtcggctccggcgcgttcatgccgagcgcggagcaa
tcggccgaactcgcgcgcagcatcgtcgacgtcggcaacggcgcggggatgaggacggcc
gcgacgctcaccgacatgaaccaggcgctcgcgccatgcgcgggcaacgcgatcgaggtg
cgctgcgcgatcgatttcctgacgggcgcggcgcgccccgcgcggctcgaagcggtcagc
ttcgcgctcgccgcgcagatgctgacgatgggcgggcttgccgcggacgcgcacgatgcg
cgccgccggttgcgcgcggtgctcgaatcgggcgcggccgcggagcggttcgcgcggatg
gtcgcggcgctcggcgggcccgccgatctggtcgagcggcccgagcggcatctgccgcgc
gcggctgccgccgcccccgtggccgccgcgcgcgccggctggatcgagcggatcgacgcg
cgcgcgctcggcctggcggtcgtcggcctgggcggcgggcgcgcgaagatcggcgacacg
ctcgattactcggtcggactgtccgcgctcgcggagctgggcgagcgcgtcgaggcgggc
cagccgctcgcgaccgttcacgcgcgcgacgccgattcggccgcgcaggcgaccgacgcg
gtgcggcgcgcctaccggatcggcgcggagccgccggcgcagacgcgcgtcgttcatgcc
gtgatcgaatga

DBGET integrated database retrieval system