KEGG   Burkholderia mallei SAVP1: BMASAVP1_1282Help
Entry
BMASAVP1_1282     CDS       T00457                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMASAVP1_1282 (pfk)
   01230 Biosynthesis of amino acids
    BMASAVP1_1282 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMASAVP1_1282 (pfk)
   00030 Pentose phosphate pathway
    BMASAVP1_1282 (pfk)
   00051 Fructose and mannose metabolism
    BMASAVP1_1282 (pfk)
   00052 Galactose metabolism
    BMASAVP1_1282 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BMASAVP1_1282 (pfk)
Enzymes [BR:bmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMASAVP1_1282 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:1278299..1279258
Genome map
AA seq 319 aa AA seqDB search
MKPNVTMPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRLGAD
CSAVYLAGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGPALA
AHEWPRCVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGPALA
AALDAGVYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGALVVS
RDDAVRLPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTGTAL
GTKEDIARIYRELPGTIDA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccgaacgtcacgatgcccgaaatcgtcaccctcacgccgaatcccgccatcgac
gtcgcgacgtgcgtcgagcgagtcaccgacacccgcaagctgcgctgcggccccgcacga
cgcgatccgggcggcggcggaatcaatgtcgcccgcgtgctgacgcgcctcggcgccgat
tgttcggccgtctacctggcgggcggcggcaccggcctcgcgctgcgcggcctgctcgcc
gacgaaggcgtgcgggcgcatggcatcgacatcgccggcgagacgcgcgaaaacttttcg
gtgctcgaaacgtcgacgggccgcgaattccgcttcgtgttgcccgggccggcgctcgcg
gcgcacgaatggccgcgctgcgtcgaagcgctcgggcggctcgccgacgcgtcgcgctat
ctggtgatgagcggcagcctgccgcccggcatgccggacgattgctacgcccggctcgcg
cggcgcgcgagcgcgcgcggcgtgcgcacggtcgtcgatacgtcgggaccggcgctcgcc
gccgcgctcgatgcgggcgtctatctggtgaagccgagcctcggcgagttgcgcgcgctg
accggcctgccgctcgaagacgacggcgcgcgccttgccgccgcgcgcgcgatcgtcgcc
ggcgggcgcgcgcagatcgtcgcgctgacgctcggcgacgcgggcgcgctcgtcgtgtcg
cgcgacgatgcggtgcgtctgccgggcgtgaaggtggcggtgcgcagcgcgatcggcgcg
ggcgacagcttcgtcgcggggctcgtcgccgcgctcaatcgcggcgcgaacgtcgccgac
gcggcgcgccatgcgctcgccgccgcgtcggcgtcgctgctgagcacgggcaccgcgctg
ggcacgaaggaagacatcgcgcggatctatcgcgaactgccggggacgatcgacgcgtga

DBGET integrated database retrieval system