KEGG   Burkholderia mallei SAVP1: BMASAVP1_1300Help
Entry
BMASAVP1_1300     CDS       T00457                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00010  Glycolysis / Gluconeogenesis
bmv00071  Fatty acid degradation
bmv00350  Tyrosine metabolism
bmv00625  Chloroalkane and chloroalkene degradation
bmv00626  Naphthalene degradation
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01130  Biosynthesis of antibiotics
bmv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMASAVP1_1300
  Lipid metabolism
   00071 Fatty acid degradation
    BMASAVP1_1300
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMASAVP1_1300
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMASAVP1_1300
   00626 Naphthalene degradation
    BMASAVP1_1300
Enzymes [BR:bmv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMASAVP1_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C TrkA_N NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABM48325
Position
II:1292237..1293262
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
NGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYAKAMGLHVVAVDVAPQKLELARKLGATFVVDASKDDPAAVIQKEIGGVHGVLV
TAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtgcatgcattcggcgaaccgcttcggatcgag
gaggtgcccgtgccgacgcccggcgcggggcagattctcgtgaacgtcaaggcatcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtcgcggcggtgggcgaaggcgtgaggcac
gtgaaggagggcgatcgcgtcggcgtgccttggctctataccgcgtgcggccattgcgag
tattgccagaccggctgggagacgctgtgccacgagcagcagaacaccggctattcggtg
aacggcagctacgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgagatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgggtgaccgacacgcgcccggggcaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtgcagtacgcgaaggcgatggggctgcacgtggtcgcggtggacgtc
gcgccgcagaagctcgagcttgcgcgcaagctgggcgcgacgttcgtcgtcgatgcgtcg
aaggacgatccggcggcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcggcgcgttcgcgcaggcgctcggcatggtgaggcgcggcgggacg
gtctcgctgaacgggctgccgccgggcgattttccgctgccgatcttctcgacggtgctc
aacgggatcacggtgcgaggctcgatcgtcggcacgcggcgcgatctccaggaatcgctc
gatttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctcgagcacatc
aacggcgtgttctcggcgctgcgtgaagggaaggtcgacgggcggatcgtgttgaccggg
caatga

DBGET integrated database retrieval system