KEGG   Burkholderia mallei SAVP1: BMASAVP1_1554Help
Entry
BMASAVP1_1554     CDS       T00457                                 

Definition
acetyltransferase
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMASAVP1_1554
   00620 Pyruvate metabolism
    BMASAVP1_1554
   00640 Propanoate metabolism
    BMASAVP1_1554
Enzymes [BR:bmv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     BMASAVP1_1554
Lipid biosynthesis proteins [BR:bmv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMASAVP1_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:1520341..1522752
Genome map
AA seq 803 aa AA seqDB search
MAARRSPSLNPFSGVAVTVRNLDALFHPTSVAVVGASPRPGSVGAMVWACVLDGRFGGAI
WPVNPKYGELNGHKVYPYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGEAR
SGADRAALERALAAAKPYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNAL
TNAVLGWAHARGLGFSHAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMS
AARAAARNKPVLALRAGRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATS
GGVTLVTSDRGVAKLAVDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARP
EYFGAALKALAQHPPTGTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAA
TRDALHVHGIPVHTTPQRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARA
ALAQGRDGFEGDAALEWLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPP
ADGVSAPFVVYGLPPFNTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMS
LVLRVRPTRVVALGPHIRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHR
ELLSAMTPDDLRMRFFGAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRA
VTDPDNEATEFAIAVRPDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAK
DSGFAVSSTEEPGVVAFRLKLQP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgcgtcgatcgccgtcgctcaatcctttcagcggagttgccgtgaccgttcgc
aatctcgatgcgttgttccatccgacatccgttgccgtcgtcggcgcttcgccgcgcccg
ggcagcgtcggcgcgatggtgtgggcgtgcgtgcttgacggccggttcggcggcgcgatc
tggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttatccctatgtcgac
cagctgccgagcgcgccgtcggtcgcgctcatatgcacgccgcccgcgacgtggcccggc
atcgtgcgcaagctgggcggcctgggcgtgcgtgcggcgatcatcgtcggcgaggctcgt
tcgggcgcagaccgggccgcgctggaacgggcgctcgccgcggcgaagccatatctgctg
cgcgtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggcgcgcatttcggc
gcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaatcgaatgcgctg
acgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcgcatgcggtcgca
ctcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctggcgagcgatgcc
gagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgcaagttcatgtcg
gcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcggggcgcggcgat
tcgggcgacctgctttacacggccgcgtttcagcgcgcggggatggtgcgcgtcgacgcg
ctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgccgcggcgacgagc
ggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgccgtcgacgcactc
gcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgacgaagtcggcggc
gcgctgcccgcgggcatcgtcgccggcaatccgttgctgctcggcgacgacgcgcggccc
gaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgacaggcaccgtgttc
gtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgtgtgctgatcgaa
tcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggcgtcgacgccgcg
acgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccgcagcgtctcgcg
cgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttgatgcagacgccg
gagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcacacggcgcgcgcg
gcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaatggctggcgggt
ttcggcatcgagcgcgcgaccgacgcggacgtcgacatgggcgatacgatcgtcgacatc
acggtcgggatgtacgacgacccgaacttcgggccggtattccgctattcggtgccgccg
gcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttcaataccgtgctc
gcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgcccgagccgcttctg
caggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatcgtcgagatgtcg
ctcgtgctgcgcgtgcggcccacacgcgtggtcgcgcttgggccgcacatcaggctcgcg
acggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgagcagcagctcgac
tggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgaggccgcgcatcgc
gagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttcggtgcgatacgc
aacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgaccgcgagatggcg
ctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggcgcggtgcgcgcg
gtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcggcctgaccaaaag
ggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcgcgctcgcgcgga
acggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatctcgctcgcgaag
gatagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcgttccggctgaag
ctgcagccgtga

DBGET integrated database retrieval system