KEGG   Burkholderia mallei SAVP1: BMASAVP1_1554Help
Entry
BMASAVP1_1554     CDS       T00457                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
bmv  Burkholderia mallei SAVP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Succ_CoA_lig CoA_binding_2 Acetyltransf_1 Acetyltransf_3 ATP-grasp_5 Acetyltransf_7 Acetyltransf_10 Acetyltransf_8 Acetyltransf_CG FR47 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: ABM49059
Position
II:1520341..1522752
Genome map
AA seq 803 aa AA seqDB search
MAARRSPSLNPFSGVAVTVRNLDALFHPTSVAVVGASPRPGSVGAMVWACVLDGRFGGAI
WPVNPKYGELNGHKVYPYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGEAR
SGADRAALERALAAAKPYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNAL
TNAVLGWAHARGLGFSHAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMS
AARAAARNKPVLALRAGRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATS
GGVTLVTSDRGVAKLAVDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARP
EYFGAALKALAQHPPTGTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAA
TRDALHVHGIPVHTTPQRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARA
ALAQGRDGFEGDAALEWLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPP
ADGVSAPFVVYGLPPFNTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMS
LVLRVRPTRVVALGPHIRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHR
ELLSAMTPDDLRMRFFGAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRA
VTDPDNEATEFAIAVRPDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAK
DSGFAVSSTEEPGVVAFRLKLQP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgcgtcgatcgccgtcgctcaatcctttcagcggagttgccgtgaccgttcgc
aatctcgatgcgttgttccatccgacatccgttgccgtcgtcggcgcttcgccgcgcccg
ggcagcgtcggcgcgatggtgtgggcgtgcgtgcttgacggccggttcggcggcgcgatc
tggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttatccctatgtcgac
cagctgccgagcgcgccgtcggtcgcgctcatatgcacgccgcccgcgacgtggcccggc
atcgtgcgcaagctgggcggcctgggcgtgcgtgcggcgatcatcgtcggcgaggctcgt
tcgggcgcagaccgggccgcgctggaacgggcgctcgccgcggcgaagccatatctgctg
cgcgtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggcgcgcatttcggc
gcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaatcgaatgcgctg
acgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcgcatgcggtcgca
ctcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctggcgagcgatgcc
gagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgcaagttcatgtcg
gcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcggggcgcggcgat
tcgggcgacctgctttacacggccgcgtttcagcgcgcggggatggtgcgcgtcgacgcg
ctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgccgcggcgacgagc
ggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgccgtcgacgcactc
gcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgacgaagtcggcggc
gcgctgcccgcgggcatcgtcgccggcaatccgttgctgctcggcgacgacgcgcggccc
gaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgacaggcaccgtgttc
gtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgtgtgctgatcgaa
tcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggcgtcgacgccgcg
acgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccgcagcgtctcgcg
cgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttgatgcagacgccg
gagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcacacggcgcgcgcg
gcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaatggctggcgggt
ttcggcatcgagcgcgcgaccgacgcggacgtcgacatgggcgatacgatcgtcgacatc
acggtcgggatgtacgacgacccgaacttcgggccggtattccgctattcggtgccgccg
gcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttcaataccgtgctc
gcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgcccgagccgcttctg
caggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatcgtcgagatgtcg
ctcgtgctgcgcgtgcggcccacacgcgtggtcgcgcttgggccgcacatcaggctcgcg
acggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgagcagcagctcgac
tggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgaggccgcgcatcgc
gagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttcggtgcgatacgc
aacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgaccgcgagatggcg
ctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggcgcggtgcgcgcg
gtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcggcctgaccaaaag
ggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcgcgctcgcgcgga
acggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatctcgctcgcgaag
gatagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcgttccggctgaag
ctgcagccgtga

DBGET integrated database retrieval system