KEGG   Burkholderia mallei SAVP1: BMASAVP1_1622Help
Entry
BMASAVP1_1622     CDS       T00457                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00020  Citrate cycle (TCA cycle)
bmv00190  Oxidative phosphorylation
bmv00650  Butanoate metabolism
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01130  Biosynthesis of antibiotics
bmv01200  Carbon metabolism
Module
bmv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMASAVP1_1622 (sdhD)
   00650 Butanoate metabolism
    BMASAVP1_1622 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BMASAVP1_1622 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABM48651
Position
II:1590600..1590968
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWFFIARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataaccgtatcggctcgaagcgcctcgtcgtcggcgcacactatggtctg
cgcgactggctggcgcagcgcgtcaccgcgagcgtgatggcgatctacaccgtcatcctg
ctcgtctggttcttcatcgcgcgcgatttctcgtacgagggctgggcgtcgatcttcgcg
acgcaatggatgaagctcgcgaccttcgtcacgctgctctcgctcttctatcacgcatgg
gtcggcgtgcgtgacatctggatggactacatcaagcccgtcggtgtgcgcctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtttaa

DBGET integrated database retrieval system