KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0143Help
Entry
BMASAVP1_A0143    CDS       T00457                                 

Definition
putative beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMASAVP1_A0143
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BMASAVP1_A0143
Enzymes [BR:bmv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BMASAVP1_A0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(153003..155504)
Genome map
AA seq 833 aa AA seqDB search
MNRISHSLCAALLAAATLLPTASRAQLPARPTAGAGAPATAAPVRPASTPAELAARLANG
LAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQNRGHSPLTDGGWKLYLHSIRRLL
RIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELPFVAEYWLRRYSDVTPRPYVVVDG
AAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAAAQPVANRALPSVKRQRALPGALD
LRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWGVVAPRRLPADIAVPGGYRLAIGP
RGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIEDAPRFTHRGMHVDLARNFKPPAT
LRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTDVGARRCHDPSETRCLLPQLGSG
PDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPAHSRAAVVSMEARYRRLHAAGRER
EANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALNFASKVIREIASMHADAQAPLRIW
HFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDKPWARSPACTALLRRGEIKSIDELP
TRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREFSTRHVMVSLWDTIFWGASDSARDLS
AKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQATDEYKVFSLAPENLPQNAEVFGDRD
GNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLLEYMVYPRLLALAERAWHKADWELPYAA
GVRYKLGDTHHVDTAALERDWAGFATVLKQRELPKLERADIGYRKPTFTLTGE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatctcgcattccctgtgcgccgcgctattggccgccgcgacgctgttgccc
acggcctcgcgcgcgcaactgcccgcgcgccccacggccggcgcgggcgcgcccgcgacg
gccgcgcccgtgcggcccgcgtccacgccggccgagctcgccgcgcggctcgccaacggc
ctcgcggtgcgcgtggccgtcgacaacaatcacgcggcatcggccggcgtgccgtgcgcc
gacctcggcgcggactgggcgagctgcgcgacgggccgcctgatcctgcagaatcgcggc
cactcgcccctcaccgacggcggctggaagctctatctgcacagcatccgccggctgctc
cgaatcgaccgccccggcttcacgctgcgccatctgacgggcgatctatacgagctgacg
ccgcagcccggcacggtaaggctcgcgcagggcgagcgcatcgagctgccgttcgtcgcc
gaatactggctgcgccgctacagcgacgtgaccccgcgcccgtacgtggtcgtcgacggc
gcggcgcccgcggtgctgcgctacgacgataccgacgacgagctgcgctacgtcgaaacg
ctgcccgccgacgcgcagaacaactcgcccggcaatgcgccgcccgccgccgcgcagccg
gtggcgaaccgcgcgctgccgagcgtgaagcggcagcgcgcgctgcccggcgcgctcgat
ctgcgcggcgtcgagctgacgctgccggagctgccgtccgcgcaggtcgcggcgctgcgc
gaacgcgcgggcacgctcggcctggacggcgcgcgcgtgccggtgtggggcgtcgtcgcg
ccgcgccggctgcccgccgacatcgcggtgccgggcggctaccggctcgcgatcggcccg
cgcggcgcgttcatcgagggggccgatcgcgcgggcctctactacggcgtgcagacgctc
ttctcgctcgtgccggccggcggcgcgacggtgcccgcgatgctgatcgaagacgcgccg
cgcttcacgcaccgcgggatgcacgtcgatctcgcgcgcaacttcaagccgcccgccacg
ctgcgccggctgatcgaccagatgagcgcgtacaagctcaaccggctgcatctgcacctg
tccgacgacgagggctggcgcatcgagattcccggcctgcccgagctgaccgacgtcggc
gcgcgccgctgccacgacccgagcgagacgcgctgcctgctgccgcagctcggctcgggg
cccgacgatcgttcgggcggcggctacctgacgcgcgacgactacgtcgcgctgctgcgc
tacgcggccgagcgcttcgtcgaagtgatccccgagatcgacatgcccgcgcactcgcgc
gcggccgtcgtatcgatggaggcgcgctatcgccgcctgcacgcggcgggccgcgagcgg
gaagcgaacgcgtatcggctgctcgatgcgcaggacacgtcgaacctgctgaccgtgcag
ttctacgaccggcgcagcgatctgaacccgtgcatgccgggcgcgctgaacttcgcgtcg
aaggtgatccgcgagatcgcgtcgatgcacgcggacgcgcaagcgccgctgcggatctgg
cacttcggcggcgacgaggcgaagaacatcctgctcggcgcgggcttccagccgctcgac
ggcgccgatcccggcaagggccgcgtcgatctcgccgcgcaggacaagccgtgggcgcgc
tcgcccgcctgtacggcgctgcttcggcgcggcgagatcaaatcgatcgacgaattgccg
acgcgcttcgcgaagcaggtcagcgcgatcgtgaacgcgaacggaatcggcacgatggcc
gcgtggcaggacggcatcaagcacgcgagcgggccgcgggagttcagcacgcggcacgtg
atggtgtcgctgtgggacaccatcttctggggcgcgtccgacagcgcgcgcgatctgagc
gcgaagggctaccggaccgtgctcgcgctgcccgattacctgtacttcgatttcccgtac
acgcgcaatccgcgcgagcgcggctattactggggctcgcaggcgacggacgagtacaag
gtgttctcgctcgcgccggagaacctgccgcagaacgccgaggtgttcggcgatcgcgac
ggcaacccgttcgaggtgacgagcgcaggcgcggcgccgagcatcgagggcatccagggg
caggcgtggggcgaggtgatgcgcaacgggcaactgctcgaatacatggtgtatccgcgc
cttctcgcgctcgccgagcgcgcgtggcacaaggccgactgggaactgccctacgcggcc
ggcgtgcgctacaagctcggcgacacgcatcacgtcgacacggccgcgctcgagcgcgac
tgggcgggcttcgcgacggtgctcaagcagcgcgaactgccgaagctcgagcgtgcggac
atcgggtatcgcaagccgacgtttacgctgacgggcgaatga

DBGET integrated database retrieval system