KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0181Help
Entry
BMASAVP1_A0181    CDS       T00457                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00010  Glycolysis / Gluconeogenesis
bmv00260  Glycine, serine and threonine metabolism
bmv00680  Methane metabolism
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01130  Biosynthesis of antibiotics
bmv01200  Carbon metabolism
bmv01230  Biosynthesis of amino acids
Module
bmv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmv_M00002  Glycolysis, core module involving three-carbon compounds
bmv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMASAVP1_A0181 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BMASAVP1_A0181 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMASAVP1_A0181 (gpmA)
Enzymes [BR:bmv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMASAVP1_A0181 (gpmA)
Membrane trafficking [BR:bmv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BMASAVP1_A0181 (gpmA)
Exosome [BR:bmv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMASAVP1_A0181 (gpmA)
  Exosomal proteins of melanoma cells
   BMASAVP1_A0181 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABM52363
UniProt: A1UZX9
Position
I:184283..185032
Genome map
AA seq 249 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKR
AIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTP
PPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTPIRHYYLGDQEAIAKAQAA
VAQQGKSAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgatgtcgacctgaccgaacaaggcaaccgcgaagcccggcaggcgggc
cagctcctgaaggaagccggctacacgttcgatatcgcatacacgtcggtgctcaagcgc
gcgatccgcacgctctggcacgtgcaggaccagatggatctgatgtacgtgcccgtcgtg
cattcgtggcgcctgaacgagcgccattacggcgcgctgtcgggcctgaacaaggcggag
acggccgcgaagtacggcgacgagcaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgggcgacgagcgcgcgccgtacgccgatccgcgctacgcgaag
gtgccgcgcgagcagttgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctctggaacgaatcgatcgcgcccgcggtgaaggccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtatctcgacggcatctccgacgcggac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtctacgagctcgacgagagcctc
acgcccatccggcactactacctcggcgatcaggaggcgatcgcgaaggcgcaggccgcc
gtcgcgcagcagggcaagtccgcggcgtaa

DBGET integrated database retrieval system