KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0267Help
Entry
BMASAVP1_A0267    CDS       T00457                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bmv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(268365..268946)
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLLEKNPPHILVDCNGVGYEVDVPMSTFYNLPHTGEKVVLLTQLIVREDAHLL
YGFLTPPERSTFRELLKITGVGARMALAVLSGMSVAELSQAVTLQDAARLTRVPGIGKKT
AERLLLELKGKLGADLGPLAGAASPSDHATDILNALVALGYSEKEALAAIKNVPAGTGVS
EGIKLSLKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcaccctcctcgaaaaaaatccgccgcacatcctcgtcgac
tgcaacggcgtcggctacgaagtcgacgtgccgatgagcacgttctacaacctgccgcac
acgggcgagaaggtcgtgctgctgacccagttgatcgtccgcgaggacgcgcacctgctg
tacggctttctcacgccgccggagcgctcgacgttccgcgagttgctcaagatcacgggc
gtcggcgcgcggatggcgcttgccgtgctgtccggcatgagcgtcgcggaactgtcgcaa
gcggtcacgctgcaggacgccgcgcgcctcacccgcgtgcccggcatcggcaagaaaacg
gccgagcgcctgctcctcgagctgaaaggcaagctcggcgccgatctcggcccgctcgcc
ggcgcggcatcgccttccgaccatgcgaccgacatcctcaacgcgctcgtcgcgctcggc
tactcggaaaaggaggcgcttgccgcgatcaagaacgtgccggccggcaccggcgtgtcc
gaaggcatcaagctgtcgctcaaggcgctgtcgaaggcgtaa

DBGET integrated database retrieval system