KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0716Help
Entry
BMASAVP1_A0716    CDS       T00457                                 

Definition
phosphoglucomutase/phosphomannomutase family protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMASAVP1_A0716
   00030 Pentose phosphate pathway
    BMASAVP1_A0716
   00051 Fructose and mannose metabolism
    BMASAVP1_A0716
   00052 Galactose metabolism
    BMASAVP1_A0716
   00500 Starch and sucrose metabolism
    BMASAVP1_A0716
   00520 Amino sugar and nucleotide sugar metabolism
    BMASAVP1_A0716
  Nucleotide metabolism
   00230 Purine metabolism
    BMASAVP1_A0716
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMASAVP1_A0716
Enzymes [BR:bmv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BMASAVP1_A0716
    5.4.2.8  phosphomannomutase
     BMASAVP1_A0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:732493..735378
Genome map
AA seq 961 aa AA seqDB search
MEIDRRGGEIAGGEARERAVEAERGNRDQVDERGERERCRPLREQHELRLILEHDEIADR
LDAGRHREPHRPAEHVDRRLEAGPEHLADDEAREQIEHERARDHQRGRHADEAPHVAAQL
RRVLHAVDERGRDCLREHQRERDPVFVQLLRGRVAAELGERHVALEHQPVELQEQVHAYE
AEPEHGARRRELAHERPLDTPAERAAVAGAVIPDQRGRDRRGFERPQPAEARGRGGRAHE
EPDERHLRERGRDAREQLRLAVRHALQPRVDDADERLAQRERHREPGQHRADERIERAQR
DCRPGERERRDRYREAQRERAAEHGAQLRARALDDGRHENLGAAYPCERREHEEQRVRVL
PFAERVGAEVAGEQAAHDDRDADLREPLEPEPREIRDGLRDVGVRKPGFQHGARRGNVRE
MTGPADRGSGFAAMKHSGIKMGAIGVAETSDYKLDRIRFRHRRCVALPPSPVGSGEDFLR
IRVEAAKFFMDDTESESMISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDA
VVVARDGRLSGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSC
IVVTGSHNPPDYNGFKMVLRGAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVER
IVGDIRLARPLKLVVDAGNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPEN
LQDVIAKLKTTDAEIGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIY
DVKCTRNLAQWVREKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDG
LYTGARLLEILARAADPSALLNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADE
VVTIDGLRVEYPDGFGLARSSNTTPVVVLRFEASSDAALVRIQDDFRRALKAAKPDANLP
F
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
gtggaaattgaccgccgcggcggcgagatagccggcggcgaggcccgcgagcgcgccgta
gaggccgagcgcgggaatcgcgatcaggttgacgagcgcggcgagcgcgagcgctgccga
ccacttcgcgagcagcacgaacttcgcctgatacttgagcacgacgagattgccgatcgc
ctcgatgccggccggcaccgagagccacaccgcccagcggaacacgtcgaccgacgtctc
gaagccgggcccgaacaccttgcggatgatgaagcccgcgagcagatcgagcacgagcgc
gcccgcgatcatcagcgcggccgtcatgccgatgaggcgccacacgttgcggcgcagttg
cggcgcgttttgcacgcggtagacgaacgcgggcgcgattgtttgcgcgagcatcagcgc
gagcgtgatccagttttcgttcaactgctgcgcggccgcgtagcggccgagctcggcgaa
cgacacgtagcgctcgagcatcagccggtcgagcttcaggaacaggtacatgcatacgag
gccgagccagaacacggtgcccgtcgtcgcgaactcgcgcacgagcggccgctcgacacg
ccagccgagcgtgccgccgttgcgggcgcggtaataccagatcagcgcggccgcgatcgc
cgcggcttcgagcgcccacagccagccgaagcgcgcgggcgcggcggccgcgcgcacgag
gagccagacgagcgccatcttcgcgagcgcggccgcgatgctcgcgagcagttgcggctt
gctgtacgtcatgctctgcagccacgcgttgacgatgccgacgaacggctcgcgcagcgc
gagcgtcaccgcgagcccggccagcatcgcgccgacgagcggatcgaacgcgcccagcgc
gattgccgcccaggtgagcgcgagcgccgcgaccgataccgtgaagcgcagcgcgaacgc
gctgccgagcacggcgcccagttgcgcgcccgtgcgctggacgatggtcggcacgagaat
ctcggcgccgcatacccatgtgagcggcgcgagcacgaggagcagcgtgttcgcgtattg
ccatttgccgaacgtgtcggggccgaagtagcgggcgagcaggccgctcacgacgatcgc
gacgccgatctgcgtgagccgctcgagcccgagccacgcgagattcgcgacggccttcgc
gacgtcggggttcgaaagcctggatttcagcatggcgcgcggcgcggcaacgtgcgcgag
atgaccgggccggccgaccgcgggagcggttttgctgcgatgaagcattcaggcattaaa
atgggcgcgatcggcgtagctgaaaccagcgattataagttggatcggattcgcttccgg
catcggcggtgcgttgcgttgcccccctcgccggtcggttcgggcgaggattttttacgc
attcgcgttgaggcggccaaattttttatggacgatacagagagtgaatcgatgatctcc
caatccatcttcaaggcatacgatattcggggcgtgatcggcaagacgctcgacgccgac
gtcgcacgctcgatcggccgcgcattcggcagcgaagtgcgcgcgcagggcggcgacgcg
gtcgtcgtcgcgcgcgacggccggctctcgggccccgagctcgtcggcgcgctcgcggac
gggctgcgcgcggcgggcgtcgatgtcgtcgacgtcggcatggtgccgacgcccgtcggc
tacttcgcggcgagcgtgccgctcgcgctgtcgggcggcgagcgccgcgtcgattcgtgc
atcgtcgtcacgggcagccacaatccgcccgactacaacggtttcaagatggtcctgcgc
ggcgccgcgatttacggcgaccagatccagggcctgtacaagcgcatcgtcgacgcgcgt
ttcgagaccggcaacggttcgtatgagcgatacgatgtcgccgatcaatacgtcgagcgc
atcgtcggcgacatcaggctcgcgcggccgctgaagctcgtcgtcgatgcgggcaacggc
gtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactcgtcgagctc
ttcaccgacatcgacggcaacttcccgaaccaccacccggacccggcgcacccggagaac
ctgcaggacgtgatcgcgaagctgaagacgaccgatgccgagatcggcttcgcgttcgac
ggcgacggcgaccgcctcggcgtcgtcacgaaggacggccagatcatctatccggaccgc
cagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcgcagatcatctac
gacgtgaagtgcacgcgcaatctcgcgcagtgggtgcgcgagaagggcggcgagccgctg
atgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgagacgggcgcgccgctc
gcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttcgacgacggc
ctctacacgggcgcgcgcctgctcgagatcctcgcgcgcgcagccgatccgagcgcgctg
ctcaacggcttgccgaacgcggtgtcgacgcccgagctgcaactgaagctcgacgaaggc
gagaacgtgaagctgatcgacaagctgcgcgccgacgcgaagttcgacggcgcggacgag
gtcgtgacgatcgacggtctgcgcgtcgagtatccggacggcttcggtctcgcgcgttcg
tcgaacacgacgcccgtggtcgtgctgcgcttcgaggcgagctccgacgcggcgctcgtg
cggatccaggacgatttccggcgcgcgctgaaggcggcgaagccggacgcgaacctgccg
ttctga

DBGET integrated database retrieval system