KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0736Help
Entry
BMASAVP1_A0736    CDS       T00457                                 

Definition
putative protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmv  Burkholderia mallei SAVP1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(752748..753401)
Genome map
AA seq 217 aa AA seqDB search
MNIEKARFNMIEQQIRPWDVLDQDVLSLLSVVKRENFVPAAYRDLAFADVELPLPSGQKM
LFPRVEARILQELAVKKHENVLEIGAGGGYMAALLAARGQRVTTVEIDPDLAKFAEENLK
KNGMTNAEVVLGDGSRGWPAKAPYDVICVSGGLPVVPQELLEQLKVGGRLAAFVGGRPVM
KAQIITRIDDTQYRVADVFETYVDHLVNAIEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaaagcacgtttcaacatgatcgaacagcagatccggccttgggatgta
ctggatcaggacgtcttgagcctgctgtcggtcgtcaagcgtgagaatttcgtgccggcc
gcgtatcgcgacctggcgttcgccgacgtcgagctgccgctgccgagcggccagaagatg
ctgttcccgcgcgtcgaggcccgcatcctgcaggagctcgcggtgaagaagcacgagaac
gtgctcgagatcggcgcgggcggcggctacatggcggccttgctggccgcgcgcggccag
cgcgtgacgacggtcgagatcgatccggatctcgcgaagttcgccgaagagaacctgaag
aagaacggcatgacgaacgccgaggtcgtgctcggcgacggctcgcgcggctggcccgcg
aaggcgccgtacgacgtgatctgcgtgtcgggcggcctgcccgtcgtcccgcaggaactg
ctcgagcaactgaaggtgggcggccgcctcgcggcgttcgtcggcggccggccggtgatg
aaggcgcagatcatcacacgcatcgacgacacgcaatatcgcgtcgccgacgtattcgag
acctacgtcgatcacctcgtcaacgcgatcgagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system