KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0779Help
Entry
BMASAVP1_A0779    CDS       T00457                                 

Gene name
pgl
Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
bmv00030  Pentose phosphate pathway
bmv01100  Metabolic pathways
bmv01110  Biosynthesis of secondary metabolites
bmv01120  Microbial metabolism in diverse environments
bmv01130  Biosynthesis of antibiotics
bmv01200  Carbon metabolism
Module
bmv_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMASAVP1_A0779 (pgl)
Enzymes [BR:bmv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     BMASAVP1_A0779 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: ABM49896
Position
I:complement(788548..789228)
Genome map
AA seq 226 aa AA seqDB search
MIEVHAFETPRAQTEALAQAVGEALAATLAQRARATLAVSGGTSPRPFLQTLSGAALDWP
RIDVTLVDDRWVPDTDDASNAKLVRETLLRNAAAHARFAPLVDLRESLDAQIAALNQSPA
HPLPDVAVLGMGEDGHTASIFADAPEWDHAIATTERFVGVHPGAAPHARVSLSLGALKRI
GRVFLLIAGSRKRAVLEAAAAAPQKNAISQLANDKGTKLDVYWCAN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaggttcacgctttcgaaaccccgcgcgcgcaaaccgaagcgctcgcgcaagcg
gtcggcgaagcgctcgcggccacgctcgcgcaacgcgcgcgcgcgacgctcgcggtgtcg
ggcggcacgagcccgcggccgttcctgcaaacgctgtcgggcgccgcgctcgactggccg
cggatcgacgtgacgctcgtcgacgaccgctgggtgcccgacaccgacgacgcgagcaac
gcgaagctcgtgcgcgagacgctgctgcgcaacgcggccgcgcacgcgcgcttcgcgccg
ctcgtcgacctgcgcgagtcgctcgacgcgcaaatcgccgcgctcaaccagagccccgcg
cacccgctgcccgacgtcgccgtgctcggcatgggcgaggacggccataccgcgtcgatc
ttcgcggacgcgcccgaatgggaccacgcgatcgcgacgaccgagcgcttcgtcggcgtc
cacccgggcgcggcgcctcatgcgcgggtgagcctgtcgctcggcgcgctcaagcgcatc
gggcgcgtgttcctgctgatcgcgggaagccgcaagcgcgcggtgctcgaggcggccgcg
gccgcgccgcagaagaacgcgatttcgcaactggccaacgacaaggggacgaagctcgat
gtctactggtgcgcaaactaa

DBGET integrated database retrieval system