KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0779Help
Entry
BMASAVP1_A0779    CDS       T00457                                 

Gene name
pgl
Definition
6-phosphogluconolactonase (EC:3.1.1.31)
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bmv01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bmv00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(788548..789228)
Genome map
AA seq 226 aa AA seqDB search
MIEVHAFETPRAQTEALAQAVGEALAATLAQRARATLAVSGGTSPRPFLQTLSGAALDWP
RIDVTLVDDRWVPDTDDASNAKLVRETLLRNAAAHARFAPLVDLRESLDAQIAALNQSPA
HPLPDVAVLGMGEDGHTASIFADAPEWDHAIATTERFVGVHPGAAPHARVSLSLGALKRI
GRVFLLIAGSRKRAVLEAAAAAPQKNAISQLANDKGTKLDVYWCAN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaggttcacgctttcgaaaccccgcgcgcgcaaaccgaagcgctcgcgcaagcg
gtcggcgaagcgctcgcggccacgctcgcgcaacgcgcgcgcgcgacgctcgcggtgtcg
ggcggcacgagcccgcggccgttcctgcaaacgctgtcgggcgccgcgctcgactggccg
cggatcgacgtgacgctcgtcgacgaccgctgggtgcccgacaccgacgacgcgagcaac
gcgaagctcgtgcgcgagacgctgctgcgcaacgcggccgcgcacgcgcgcttcgcgccg
ctcgtcgacctgcgcgagtcgctcgacgcgcaaatcgccgcgctcaaccagagccccgcg
cacccgctgcccgacgtcgccgtgctcggcatgggcgaggacggccataccgcgtcgatc
ttcgcggacgcgcccgaatgggaccacgcgatcgcgacgaccgagcgcttcgtcggcgtc
cacccgggcgcggcgcctcatgcgcgggtgagcctgtcgctcggcgcgctcaagcgcatc
gggcgcgtgttcctgctgatcgcgggaagccgcaagcgcgcggtgctcgaggcggccgcg
gccgcgccgcagaagaacgcgatttcgcaactggccaacgacaaggggacgaagctcgat
gtctactggtgcgcaaactaa

DBGET integrated database retrieval system