KEGG   Burkholderia mallei SAVP1: BMASAVP1_A0919Help
Entry
BMASAVP1_A0919    CDS       T00457                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bmv00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:913234..914319
Genome map
AA seq 361 aa AA seqDB search
MRVAHPGAVWQHVGITHIMTTDTSGRTGNPAAAAPAERFRYGFLKGNPQLTKNGELKHLL
TIEGLPRAILNQILDTAEQFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKR
LSADVINLNINASSTSKGESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVI
NAGDGRHAHPTQGLLDMYTIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVR
AIGPRTLLPGGLEQMGVRVFHNLDEGLRDVDVIIMLRLQNERMSGALLPSAQEYFKSWGL
TPERLALAAPDAIVMHPGPMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGTS
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtcgcgcatccgggcgccgtttggcaacacgttggaatcacgcacatcatgacg
accgacacctccggccgcaccggcaatcccgccgcggccgcgcccgccgagcgctttcgc
tatggctttctgaagggcaacccgcagctcacgaagaacggcgagctcaagcatctgttg
acgatcgagggcctgccgcgcgcgatcctcaatcagattctcgacaccgccgagcagttc
gtcagcgtgaccgaccgcgaagtgaagaaggtgccgctcttgcgcggcaaatcggtattc
aacctgttcttcgagaattcgacgcgcacgcgcacgacgttcgagatcgccgcgaagcgg
ctgtccgccgacgtgatcaacctgaacatcaacgcgtcgtcgacgagcaagggcgagtcg
ctcctcgacacgatcaacaatctgtcggcgatgcacgccgatctcttcgtcgtgcgccac
gcatcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcacgtgatc
aacgcgggcgacggccgtcacgcgcacccgacgcagggccttctcgacatgtacacgatc
cgccactacaagcgcgacttcacgaagctgcgcgtcgcgatcgtcggcgacattctccat
tcgcgcgtcgcgcgctcggacattcacgcgctgacgacgctcggcgtgcccgaggtgcgc
gcgatcggcccgcgcacgctgctgccgggcgggctcgagcagatgggcgtgcgcgtgttc
cacaatctcgacgaaggcctgagggacgtcgacgtgatcatcatgctgcgcctgcagaac
gagcggatgagcggcgcgctgctgccgtccgcgcaggaatatttcaagagctggggcttg
acgcccgagcgccttgcgctcgccgcgcccgacgcgatcgtgatgcacccggggccgatg
aaccgcggcgtcgagatcgattcgcaagtggccgacggcccgcaatcggtgatcctgaac
caggtgacgttcggcatcgcggtgcgcatggccgtgatgggcatcgtcgcgggcacgagc
gactga

DBGET integrated database retrieval system