KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1335Help
Entry
BMASAVP1_A1335    CDS       T00457                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMASAVP1_A1335 (malQ)
Enzymes [BR:bmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BMASAVP1_A1335 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(1305458..1307680)
Genome map
AA seq 740 aa AA seqDB search
MTADPRHPSIVELADAAGLDAHWIDASGFARRVGDDMLAALLDALGYPCDTRAARAESAA
RLAAHAQAAPRLVTGDVDAPLTLPASLGRPGACYRVTLENGDAVAGRFAQPAGAAVLPPL
ATPGYHVLDTGEQRTTLAIAPPSAWTPADAMRAAAAGGRERPPPWGLAAQLYGLRREADG
GIGDFTALAACARAAARRGAHALAISPTQAAFPALPEHDSPYSPSSRLWRNAAYIDVETV
LGAHAARAAIADAGLAAQWSALTRAPLVDWPGAVPAKLRVLRLLFDRWRAQAPTGADAGP
RAFARFRARHAGALDAHATFDALQACCIDNGIGADWRRWPPAWRTPDAPDVAAFARAHAH
DIAFHAFLQWQAARGLAAAQRAARGRGMAIGLIADLPVGCDAAGSDAWRDGDAMLRGLSI
GAPADPFNARGQAWGVTTWTPTALRARGFAPFVECLRAGFAHAGGVRIDHVLGLARLWVV
RDGAPPRDGAYLRYPRDDLLRLAALESFRHRAIVIGEDLGTVPADFRARIAARGIVGLRA
LWFERDPAGAFRAPGDWDRHAAATSSTHDLPTVAGWWRGVDLGWRWRAAASASACAPASS
LSPASDAEAEANAPPARPGESEVAGPDALPPEVRDMRRAERAALWRALQQAGVAARGQKM
PPRDAPPVGAILAYVAQAPAPLAIFPLEDLLALEGQPNVPGPPCGHPNWRRRMPRSVDAL
FDAPARTRIAAVRRARKRAR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgatccgcgtcatccgtcgatcgtcgagctcgcggacgcggccgggctcgac
gcgcactggatcgacgcatcgggcttcgcgcggcgggtcggcgacgacatgctcgcggcg
ttgctcgacgcgctcggctacccgtgcgacacgcgcgcggcgcgcgccgagagcgccgcg
cggctcgcggcgcacgcgcaggccgcgccgcggctcgtgacgggcgacgtcgacgcgccg
ctcacgctgcccgcctcgctcggacgccccggcgcgtgctaccgggtcaccctcgaaaac
ggcgacgccgtcgccggccgcttcgcgcagcccgccggcgcagccgtgctgccgccgctc
gcgacgcccggctaccacgtgctcgacaccggcgagcagcgcacaacgctcgccatcgca
ccgccatccgcatggacgcccgccgacgcgatgcgcgccgcggcggccggcggccgcgaa
cgcccgccgccgtggggcctcgcggcgcaactctacgggctgcgccgcgaggccgacggc
ggcatcggcgatttcaccgcgctcgccgcctgcgcgcgcgccgccgcccggcgcggcgcg
cacgcgctcgcgatcagcccgacgcaggcggccttccccgcgctgcccgagcacgacagc
ccgtactcgccttcgtcgcggctttggcgcaacgccgcctacatcgacgtcgaaacggtg
ctcggcgcgcacgcggcgcgcgcggcgatcgccgatgcggggctcgccgcgcaatggagc
gcgctcacgcgcgcgccgctcgtcgattggcccggcgcggtgccggcgaagctgcgcgtg
ctgcgcctgctgttcgaccgctggcgcgcgcaggcgcccacgggcgcggatgcgggcccg
cgggcgttcgcgcgctttcgggcacggcacgccggcgcgctcgacgcacatgcgacgttc
gacgcgttgcaggcgtgctgcatcgacaacggcatcggcgcggactggcggcgttggccg
cccgcatggcgcacgcccgatgcgccggacgtcgccgcgttcgcgcgcgcgcacgcgcac
gacatcgcgttccacgccttcctgcaatggcaggccgcgcgcgggctcgcggccgcgcaa
cgcgccgcgcgcggccgcggcatggcgatcggcctgatcgcggacttgccggtcggctgc
gacgcggcgggcagcgacgcgtggcgggacggcgatgcgatgctgcgcggcctgtcgatc
ggcgcgcccgccgatccgttcaacgcgcgcggccaggcatggggcgtcaccacgtggacg
ccgacggcgctgcgcgcgcggggcttcgcgccgttcgtcgaatgtctgcgcgcgggcttc
gcgcacgcgggaggcgttcgcatcgatcacgtgctcggcctcgcgcggctgtgggtggtg
cgcgacggcgcgccgccgcgcgacggcgcgtacctgcgctatccgcgcgacgatttgctg
cggctcgccgcgctcgaatcgttccggcatcgcgcgatcgtcatcggcgaggatctcggc
accgtgccggcggatttccgcgcgcggatcgccgcgcgcggcatcgtcggcctgcgcgcg
ctctggttcgaacgggacccggcgggcgcgttccgcgcgccgggcgattgggatcgtcac
gcggccgcgacgagctcgacgcacgatctgccgacggtcgcgggctggtggcgcggcgtc
gatctcggctggcgatggcgcgcggccgcctccgcctcggcctgcgcgcccgcgtcctcc
ctctctcccgcctccgacgccgaggccgaggcgaacgccccgcccgcgcggcccggcgaa
tcggaggtcgccgggccggatgcgctgccgcccgaggtgcgcgacatgcgccgcgccgag
cgcgcggcgctctggcgcgcgctgcagcaagccggcgtcgccgcgcgcgggcaaaagatg
ccgccgcgggatgcgccccccgtcggtgcgatactcgcgtacgtcgcgcaagcgcccgcg
ccgctcgcgatctttccgctcgaggatctgctcgcgctcgagggccagccgaacgtgccg
ggcccgccgtgcgggcacccgaactggcggcggcgcatgccgcgctccgtcgacgcgctg
ttcgacgcgccggcgcgcacgcgcatcgccgccgtgcggcgcgcgaggaagcgcgcgcga
tga

DBGET integrated database retrieval system